| UniProt ID | VPS25_DROME | |
|---|---|---|
| UniProt AC | Q7JXV9 | |
| Protein Name | Vacuolar protein-sorting-associated protein 25 | |
| Gene Name | Vps25 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 174 | |
| Subcellular Localization | Cytoplasm. Endosome membrane. | |
| Protein Description | Component of the ESCRT-II complex (ensodomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex (By similarity). Seems to function as a tumor suppressor by regulating Notch trafficking, hence preventing non-autonomous overproliferation. May be involved in the regulation of autophagy. ESCRT-II interacts with bicoid mRNA, which is required for the anterior localization of bicoid mRNA in the developing egg.. | |
| Protein Sequence | MAEFQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSIGDQNSPLFHNEALKRRLSPELVLAILGELERSGHANPLDKRRQEWQVYWFTLEEYGNMVYDWVQETGQTNTICTLYEIASGENTSHLDFYGVDEAVLLSALRLLEEKGRCELIEMDGSHGVKFF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of VPS25_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VPS25_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VPS25_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VPS25_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NOTCH_DROME | N | genetic | 16611691 | |
| NOTCH_DROME | N | genetic | 19132102 | |
| HIPPO_DROME | hpo | genetic | 16611691 | |
| DIAP1_DROME | th | genetic | 16611691 | |
| STAT_DROME | Stat92E | genetic | 16256743 | |
| BECN1_DROME | Atg6 | genetic | 23406899 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
