UniProt ID | VHL_RAT | |
---|---|---|
UniProt AC | Q64259 | |
Protein Name | von Hippel-Lindau disease tumor suppressor | |
Gene Name | Vhl | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 185 | |
Subcellular Localization |
Cytoplasm. Membrane Peripheral membrane protein. Nucleus. Colocalizes with ADRB2 at the cell membrane.. |
|
Protein Description | Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2 (By similarity).. | |
Protein Sequence | MPRKAASPEEAERMPGSEEIEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPLWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVRKDIQRLTQEHLENQALGEEPEGVH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of VHL_RAT !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VHL_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VHL_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VHL_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EPAS1_RAT | Epas1 | physical | 12675925 | |
ELOB_HUMAN | TCEB2 | physical | 9122164 | |
ELOC_HUMAN | TCEB1 | physical | 9122164 | |
CDN2A_HUMAN | CDKN2A | physical | 7604013 | |
ARF_HUMAN | CDKN2A | physical | 7604013 | |
EXOS8_HUMAN | EXOSC8 | physical | 7604013 | |
ELOB_HUMAN | TCEB2 | physical | 7660122 | |
ELOC_HUMAN | TCEB1 | physical | 7660122 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...