UFE1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UFE1_SCHPO
• UniProt AC: O94531
• Protein Name: Syntaxin ufe1
• Gene Name: ufe1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 319
• Subcellular Localization: Endoplasmic reticulum membrane; Single-pass type IV membrane protein.
• Protein Description: Syntaxin required for targeting and fusion of Golgi-derived retrograde transport vesicles with the ER..
• Protein Sequence: MTSRTNEFFGLTKNGDIDAANIPLKRISYTDPFLAEGYRIHETIVNLLVFLKKIRGAYLKDRTFSNVQRLSKPLMECSLEELSKLELDEVQRDEIEHEVSSAISSCIHQIAKLQEIVKEQQSQIPKKSGWLQGLRDPSKLSKKETLVAHHSSVLWYLQSELSDVSSVLYHLQDLRLKRGQEKRNIASDFLTKNPTDENSAVEIPESELQTFFTQQQLQELEQENDVLLQEFEHTMERLRDTGKSLADITRLQSEISAQLSIQSSAAEKLYDDALNVMDSLSGGNQQLIKAKSRSSRTARLLFCIFTVMGLLLLSLDRIV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of UFE1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UFE1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UFE1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UFE1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KMS1_SCHPO	kms1	physical	14655046
SAD1_SCHPO	sad1	physical	14655046
UFE1_SCHPO	ufe1	physical	14655046

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.