UniProt ID | UFD1_SCHPO | |
---|---|---|
UniProt AC | O42915 | |
Protein Name | Ubiquitin fusion degradation protein 1 | |
Gene Name | ufd1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 342 | |
Subcellular Localization | ||
Protein Description | Functions at a post-ubiquitation step in the ubiquitin fusion degradation (UFD) pathway. It is required for vegetative growth (By similarity).. | |
Protein Sequence | MFGGSFFSSDDDGFSMMSQLRSAFHNNVNQRFDTRYRCYPVAMIPGEERPNVNYGGKVILPPSALEKLSRLNVSYPMLFDFENEAAEKKTHGGVLEFIAEEGRVYLPYWMMTTLSLEPGDLVRVINTDIAQGSYVKLQPQSVNFLDITDHRAVLENALRNFSTLTKSDIFEILYNDQVYQIKVIDVQPDDSRHVVSVVETDLVVDFDPPIGYEESLQKNKQQNIAGVQGTMVTKIGYDELVRQGDSNLMKGTGTKLNGKEVAEVPKINLLDVEKQECPAPLILPLGTYFFGYPYKAPSIEEDSKKDPNLFKFEGAGTSLRASRKTNGTMGKGSSDDPIDIDA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
298 | Phosphorylation | GYPYKAPSIEEDSKK CCCCCCCCCCCCCCC | 47.71 | 25720772 | |
317 | Phosphorylation | FKFEGAGTSLRASRK CCCCCCCCCCEEECC | 24.85 | 21712547 | |
318 | Phosphorylation | KFEGAGTSLRASRKT CCCCCCCCCEEECCC | 18.23 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UFD1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UFD1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UFD1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NPL4_SCHPO | npl4 | physical | 22730331 | |
RAD22_SCHPO | rad52 | genetic | 24265825 | |
HUS2_SCHPO | rqh1 | genetic | 24265825 | |
RAD18_SCHPO | rhp18 | genetic | 24265825 | |
UBC13_SCHPO | ubc13 | genetic | 24265825 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...