UniProt ID | UFD1_DROME | |
---|---|---|
UniProt AC | Q9VTF9 | |
Protein Name | Ubiquitin fusion degradation protein 1 homolog | |
Gene Name | Ufd1-like | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 316 | |
Subcellular Localization | ||
Protein Description | Functions at a post-ubiquitation step in the ubiquitin fusion degradation (UFD) pathway.. | |
Protein Sequence | MFHFSGFNMMFPEGRNFHANYKCFSVSMLPGNERTDVEKGGKIIMPPSALDTLTRLNVEYPMLFKLTNVKKSRSSHAGVLEFVADEGKCYLPHWMMENLLLGEGDILNIESVSLPVATFSKFQPHSTDFLDITNPKAVLENALRNFACLTRGDVIAIKYNKKVYELCVLETKPGNAVSIIECDMNVEFEAPVGYKDHSETQASGSGQQGAAGTVGGEIAGATNAILEEVVETFKGSGVRLDGKKKKESQLETPVVKKVLARGVPDYDFQFGLIRFDRNIRPISDRSQEDDAVAGNADASDAESFHGTGFSMKKTRK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
158 | Ubiquitination | RGDVIAIKYNKKVYE CCCEEEEEECCEEEE | 33.48 | 31113955 | |
248 | Phosphorylation | DGKKKKESQLETPVV CCCCCCHHHCCCHHH | 49.28 | 22817900 | |
266 | Phosphorylation | LARGVPDYDFQFGLI HHCCCCCCCCCCEEE | 16.76 | 18281928 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UFD1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UFD1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UFD1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NPL4_DROME | Npl4 | physical | 22036573 | |
TERA_DROME | TER94 | physical | 23747190 | |
RBX1A_DROME | Roc1a | physical | 23747190 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...