dbPTM

RBX1A_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RBX1A_DROME
UniProt AC	Q9W5E1
Protein Name	RING-box protein 1A
Gene Name	Roc1a
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	108
Subcellular Localization	Cytoplasm. Nucleus.
Protein Description	Core component of multiple SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Required for the specific SCF-dependent proteolysis of CI, but not that of ARM, suggesting that it also participates in the selection of substrates inside the SCF complex. [PubMed: 12062088 During early metamorphosis, part of the SCF-slmb complex that negatively regulates the InR/PI3K/TOR pathway to activate the pruning of unnecessary larval ddaC dendrites and mushroom body axons]
Protein Sequence	MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RBX1A_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RBX1A_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RBX1A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RBX1A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CUL1_DROME	Cul1	physical	18698375
CUL1_DROME	Cul1	physical	15331761
TERA_DROME	TER94	physical	23747190
UFD1_DROME	Ufd1-like	physical	23747190

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RBX1A_DROME

Related Literatures of Post-Translational Modification