UBC9_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UBC9_CAEEL
• UniProt AC: Q95017
• Protein Name: SUMO-conjugating enzyme UBC9
• Gene Name: ubc-9
• Organism: Caenorhabditis elegans.
• Sequence Length: 166
• Subcellular Localization: Nucleus envelope .
• Protein Description: Accepts the ubiquitin-like protein smo-1 from the aos-1-uba-2 E1 complex and catalyzes its covalent attachment to other proteins with the help of an E3 ligase such as gei-17. Required to sumoylate the ETS transcription factor lin-1 and the Polycomb protein sop-2. Required for embryonic development, fertility, vulval morphogenesis and inhibition of vulval cell fates..
• Protein Sequence: MSGIAAGRLAEERKHWRKDHPFGFIAKPVKNADGTLNLFNWECAIPGRKDTIWEGGLYRIRMLFKDDFPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDENKDWKPSISIKQLLIGIQDLLNHPNIEDPAQAEAYQIYCQNRAEYEKRVKKEAVKYAAELVQKQMLE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of UBC9_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UBC9_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UBC9_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UBC9_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUMO_CAEEL	smo-1	physical	14704431
BARD1_CAEEL	brd-1	physical	14704431
UBC9_CAEEL	ubc-9	physical	14704431
SOP2_CAEEL	sop-2	physical	15107848

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.