UniProt ID | UB2E3_MOUSE | |
---|---|---|
UniProt AC | P52483 | |
Protein Name | Ubiquitin-conjugating enzyme E2 E3 | |
Gene Name | Ube2e3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 207 | |
Subcellular Localization | Nucleus. Cytoplasm. Shuttles between the nucleus and cytoplasm in a IPO11-dependent manner. | |
Protein Description | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination (By similarity). Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest.. | |
Protein Sequence | MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSSDRQRSD ------CCCCCCCCC | 40.73 | - | |
2 | Phosphorylation | ------MSSDRQRSD ------CCCCCCCCC | 40.73 | 23375375 | |
8 | Phosphorylation | MSSDRQRSDDESPST CCCCCCCCCCCCCCC | 40.87 | 25521595 | |
12 | Phosphorylation | RQRSDDESPSTSSGS CCCCCCCCCCCCCCC | 31.01 | 25159016 | |
14 | Phosphorylation | RSDDESPSTSSGSSD CCCCCCCCCCCCCCC | 50.64 | 25159016 | |
15 | Phosphorylation | SDDESPSTSSGSSDA CCCCCCCCCCCCCCH | 30.23 | 25159016 | |
16 | Phosphorylation | DDESPSTSSGSSDAD CCCCCCCCCCCCCHH | 36.72 | 25159016 | |
17 | Phosphorylation | DESPSTSSGSSDADQ CCCCCCCCCCCCHHH | 42.66 | 25159016 | |
19 | Phosphorylation | SPSTSSGSSDADQRD CCCCCCCCCCHHHCC | 27.30 | 25159016 | |
20 | Phosphorylation | PSTSSGSSDADQRDP CCCCCCCCCHHHCCC | 40.10 | 25159016 | |
58 | Acetylation | LSSKTTAKLSTSAKR CCHHHHHHHHHHHHH | 40.66 | 23806337 | |
60 | Phosphorylation | SKTTAKLSTSAKRIQ HHHHHHHHHHHHHHH | 21.43 | 29514104 | |
91 | Phosphorylation | GPKGDNIYEWRSTIL CCCCCCEEEECCCEE | 18.72 | 22817900 | |
145 | S-palmitoylation | INSQGVICLDILKDN CCCCCEEEEHHHCCC | 2.31 | 28680068 | |
150 | Ubiquitination | VICLDILKDNWSPAL EEEEHHHCCCCCCCH | 49.72 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UB2E3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2E3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2E3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RCBT1_MOUSE | Rcbtb1 | physical | 19256485 | |
RNF5_MOUSE | Rnf5 | physical | 19256485 | |
ARI2_MOUSE | Arih2 | physical | 19256485 | |
RCBT1_HUMAN | RCBTB1 | physical | 19256485 | |
RNF25_HUMAN | RNF25 | physical | 19256485 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative time-resolved phosphoproteomic analysis of mast cellsignaling."; Cao L., Yu K., Banh C., Nguyen V., Ritz A., Raphael B.J., Kawakami Y.,Kawakami T., Salomon A.R.; J. Immunol. 179:5864-5876(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-91, AND MASSSPECTROMETRY. |