| UniProt ID | U2AF1_SCHPO | |
|---|---|---|
| UniProt AC | Q09176 | |
| Protein Name | Splicing factor U2AF 23 kDa subunit | |
| Gene Name | SPAP8A3.06 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 216 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Necessary for the splicing of pre-mRNA. The SF1-U2AF59-U2AF23 complex has a role in the recognition of the branch site (5'-UACUAAC-3'), the pyrimidine tract and the 3'-splice site at the 3'-end of introns.. | |
| Protein Sequence | MASHLASIYGTEQDKVNCSFYYKIGACRHGERCSRKHVKPNFSQTILCPNMYKNPIHEPNGKKFTQRELAEQFDAFYEDMFCEFSKYGEVEQLVVCDNVGDHLVGNVYVRFKYEESAQNAIDDLNSRWYSQRPVYAELSPVTDFREACCRQHETSECQRGGLCNFMHAKKPSPQLLRDLVLAQRKYLALNAAEEMKKEPNSDSTNRWVSVTAERKN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 130 | Phosphorylation | DLNSRWYSQRPVYAE HHHHCHHHCCCCEEE | 16.86 | 25720772 | |
| 139 | Phosphorylation | RPVYAELSPVTDFRE CCCEEECCCCCCHHH | 14.61 | 25720772 | |
| 142 | Phosphorylation | YAELSPVTDFREACC EEECCCCCCHHHHHH | 32.57 | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of U2AF1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of U2AF1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of U2AF1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| U2AF2_SCHPO | prp2 | physical | 10923022 | |
| U2AF2_SCHPO | prp2 | physical | 11686295 | |
| PRP45_SCHPO | prp45 | physical | 11414703 | |
| YC83_SCHPO | SPCC622.03c | genetic | 22681890 | |
| SEC7B_SCHPO | sec72 | genetic | 22681890 | |
| YQMA_SCHPO | SPCP1E11.10 | genetic | 22681890 | |
| U2AF2_SCHPO | prp2 | physical | 23695164 | |
| SRP2_SCHPO | srp2 | genetic | 26302002 | |
| U2AF2_SCHPO | prp2 | physical | 26771498 | |
| U2AF2_SCHPO | prp2 | physical | 26215567 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
