| UniProt ID | TTG1_ARATH | |
|---|---|---|
| UniProt AC | Q9XGN1 | |
| Protein Name | Protein TRANSPARENT TESTA GLABRA 1 | |
| Gene Name | TTG1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 341 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | May regulate MYC transcription factors. Involved in epidermal cell fate specification such as trichome and root hair development, seed mucilage production, and anthocyanin biosynthesis by acting at the dihydroflavonol-4-reductase (DFR) step. Together with GL1 and GL3, promotes trichome formation. Activates the transcription of GL2.. | |
| Protein Sequence | MDNSAPDSLSRSETAVTYDSPYPLYAMAFSSLRSSSGHRIAVGSFLEDYNNRIDILSFDSDSMTVKPLPNLSFEHPYPPTKLMFSPPSLRRPSSGDLLASSGDFLRLWEINEDSSTVEPISVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWDIEKSVVETQLIAHDKEVHDIAWGEARVFASVSADGSVRIFDLRDKEHSTIIYESPQPDTPLLRLAWNKQDLRYMATILMDSNKVVILDIRSPTMPVAELERHQASVNAIAWAPQSCKHICSGGDDTQALIWELPTVAGPNGIDPMSVYSAGSEINQLQWSSSQPDWIGIAFANKMQLLRV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MDNSAPDS -------CCCCCCCC | 11.26 | 22223895 | |
| 93 | Phosphorylation | PPSLRRPSSGDLLAS CCCCCCCCCCCCEEC | 45.18 | 25561503 | |
| 94 | Phosphorylation | PSLRRPSSGDLLASS CCCCCCCCCCCEECC | 38.72 | 25561503 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TTG1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TTG1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TTG1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GL1_ARATH | MYB0 | genetic | 10101180 | |
| GL3_ARATH | GL3 | physical | 11063707 | |
| GL3_ARATH | GL3 | physical | 14561633 | |
| TT8_ARATH | TT8 | physical | 15255866 | |
| GL3_ARATH | GL3 | physical | 22028035 | |
| EGL1_ARATH | EGL3 | physical | 22028035 | |
| TT8_ARATH | TT8 | physical | 22028035 | |
| BH012_ARATH | ATMYC1 | physical | 22334670 | |
| GEM_ARATH | GEM | physical | 17450124 | |
| WRK44_ARATH | TTG2 | physical | 25304203 | |
| GL3_ARATH | GL3 | physical | 25926482 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
