dbPTM

WRK44_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	WRK44_ARATH
UniProt AC	Q9ZUU0
Protein Name	WRKY transcription factor 44
Gene Name	WRKY44
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	429
Subcellular Localization	Nucleus .
Protein Description	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Regulates trichome development, production of mucilage and tannin in seed coats, and maybe root hair development..
Protein Sequence	MEVNDGERVVIAKPVASRPSSSSGFRTFTELLTDSVTVSPQTTCHEIVDAAIRPKTLRFNQPVAASVSCPRAEVKGIGNGMSCDDDSDSRNYVVYKPKAKLVSKATVSALANMLQGNRQQTWRQSEAVSYGKSVSQGTHRAGPNLVQKVPSFTESETSTGDRSSVDGYNWRKYGQKQVKGSECPRSYYKCTHPKCPVKKKVERSVEGQVSEIVYQGEHNHSKPSCPLPRRASSSISSGFQKPPKSIASEGSMGQDPNNNLYSPLWNNQSNDSTQNRTEKMSEGCVITPFEFAVPRSTNSNPGTSDSGCKSSQCDEGELDDPSRSKRRKNEKQSSEAGVSQGSVESDSLEDGFRWRKYGQKVVGGNAYPRSYYRCTSANCRARKHVERASDDPRAFITTYEGKHNHHLLLSPPSSSTLPFNSPQLSKQTI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of WRK44_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of WRK44_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of WRK44_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of WRK44_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
WRK44_ARATH	TTG2	physical	25304203
TTG1_ARATH	TTG1	physical	25304203

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of WRK44_ARATH

Related Literatures of Post-Translational Modification