dbPTM

TT1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TT1_ARATH
UniProt AC	Q8VWG3
Protein Name	Protein TRANSPARENT TESTA 1
Gene Name	TT1 {ECO:0000303\|PubMed:11782451}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	303
Subcellular Localization	Nucleus .
Protein Description	May act as a transcriptional regulator involved in the differentiation of young endothelium. Altered differentiation results in incompetence for pigments synthesis and the lack of condensed tannins in the seed coat. [PubMed: 21477081 Plays a role in the regulatory network controlling flavonoid accumulation in endothelium cells during seed development]
Protein Sequence	MESPPLYEISSSSSSEKPRHHFQSLDLFPNLNQNSCINNTLIEPLPLIDRINLNSNLDLNPNPLYAEEGEQEEEEEEEEDREVDVDLHIGLPGFGKPSNDAKQLKKRNGKEIATYDAGKGIENELSGKAYWIPAPEQILIGFTHFSCHVCFKTFNRYNNLQMHMWGHGSQYRKGPESLKGTQPRAMLGIPCYCCVEGCRNHIDHPRSKPLKDFRTLQTHYKRKHGHKPFSCRLCGKLLAVKGDWRTHEKNCGKRWVCVCGSDFKHKRSLKDHVKAFGSGHGPYPTGLFEEQASNSSVSETLFF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of TT1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TT1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TT1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TT1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TT1_ARATH	TT1	physical	21477081
TT2_ARATH	TT2	physical	21477081
MYB75_ARATH	PAP1	physical	21477081

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TT1_ARATH

Related Literatures of Post-Translational Modification