UniProt ID | MYB75_ARATH | |
---|---|---|
UniProt AC | Q9FE25 | |
Protein Name | Transcription factor MYB75 | |
Gene Name | MYB75 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 248 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription activator, when associated with BHLH12/MYC1, EGL3, or GL3. Promotes the synthesis of. phenylpropanoid-derived compounds such as anthocyanins and proanthocyanidin, probably together with GL3 and BHLH2. Regulates the expression of CHS, DFRA, LDOX, and BAN.. | |
Protein Sequence | MEGSSKGLRKGAWTTEEDSLLRQCINKYGEGKWHQVPVRAGLNRCRKSCRLRWLNYLKPSIKRGKLSSDEVDLLLRLHRLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHEPCCKIKMKKRDITPIPTTPALKNNVYKPRPRSFTVNNDCNHLNAPPKVDVNPPCLGLNINNVCDNSIIYNKDKKKDQLVNNLIDGDNMWLEKFLEESQEVDILVPEATTTEKGDTLAFDVDQLWSLFDGETVKFD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MYB75_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MYB75_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MYB75_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MYB75_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GL3_ARATH | GL3 | physical | 15361138 | |
EGL1_ARATH | EGL3 | physical | 15361138 | |
BH012_ARATH | ATMYC1 | physical | 15361138 | |
TT8_ARATH | TT8 | physical | 15361138 | |
SPA1_ARATH | SPA1 | physical | 23425305 | |
SPA2_ARATH | SPA2 | physical | 23425305 | |
SPA3_ARATH | SPA3 | physical | 23425305 | |
SPA4_ARATH | SPA4 | physical | 23425305 | |
COP1_ARATH | COP1 | physical | 23425305 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...