MYB75_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MYB75_ARATH
• UniProt AC: Q9FE25
• Protein Name: Transcription factor MYB75
• Gene Name: MYB75
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 248
• Subcellular Localization: Nucleus .
• Protein Description: Transcription activator, when associated with BHLH12/MYC1, EGL3, or GL3. Promotes the synthesis of. phenylpropanoid-derived compounds such as anthocyanins and proanthocyanidin, probably together with GL3 and BHLH2. Regulates the expression of CHS, DFRA, LDOX, and BAN..
• Protein Sequence: MEGSSKGLRKGAWTTEEDSLLRQCINKYGEGKWHQVPVRAGLNRCRKSCRLRWLNYLKPSIKRGKLSSDEVDLLLRLHRLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHEPCCKIKMKKRDITPIPTTPALKNNVYKPRPRSFTVNNDCNHLNAPPKVDVNPPCLGLNINNVCDNSIIYNKDKKKDQLVNNLIDGDNMWLEKFLEESQEVDILVPEATTTEKGDTLAFDVDQLWSLFDGETVKFD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of MYB75_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MYB75_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MYB75_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MYB75_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GL3_ARATH	GL3	physical	15361138
EGL1_ARATH	EGL3	physical	15361138
BH012_ARATH	ATMYC1	physical	15361138
TT8_ARATH	TT8	physical	15361138
SPA1_ARATH	SPA1	physical	23425305
SPA2_ARATH	SPA2	physical	23425305
SPA3_ARATH	SPA3	physical	23425305
SPA4_ARATH	SPA4	physical	23425305
COP1_ARATH	COP1	physical	23425305

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.