UniProt ID | TT2_ARATH | |
---|---|---|
UniProt AC | Q9FJA2 | |
Protein Name | Transcription factor TT2 | |
Gene Name | TT2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 258 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS).. | |
Protein Sequence | MGKRATTSVRREELNRGAWTDHEDKILRDYITTHGEGKWSTLPNQAGLKRCGKSCRLRWKNYLRPGIKRGNISSDEEELIIRLHNLLGNRWSLIAGRLPGRTDNEIKNHWNSNLRKRLPKTQTKQPKRIKHSTNNENNVCVIRTKAIRCSKTLLFSDLSLQKKSSTSPLPLKEQEMDQGGSSLMGDLEFDFDRIHSEFHFPDLMDFDGLDCGNVTSLVSSNEILGELVPAQGNLDLNRPFTSCHHRGDDEDWLRDFTC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Phosphorylation | THGEGKWSTLPNQAG HCCCCCCCCCCCHHH | 24.45 | 24894044 | |
41 | Phosphorylation | HGEGKWSTLPNQAGL CCCCCCCCCCCHHHH | 45.15 | 24894044 | |
73 | Phosphorylation | GIKRGNISSDEEELI CCCCCCCCCCHHHHH | 35.42 | 19880383 | |
152 | Phosphorylation | KAIRCSKTLLFSDLS CEEECCCEEEECCCC | 16.64 | 19880383 | |
159 | Phosphorylation | TLLFSDLSLQKKSST EEEECCCCCCCCCCC | 33.47 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TT2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TT2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TT2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...