dbPTM

TT2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TT2_ARATH
UniProt AC	Q9FJA2
Protein Name	Transcription factor TT2
Gene Name	TT2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	258
Subcellular Localization	Nucleus.
Protein Description	Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS)..
Protein Sequence	MGKRATTSVRREELNRGAWTDHEDKILRDYITTHGEGKWSTLPNQAGLKRCGKSCRLRWKNYLRPGIKRGNISSDEEELIIRLHNLLGNRWSLIAGRLPGRTDNEIKNHWNSNLRKRLPKTQTKQPKRIKHSTNNENNVCVIRTKAIRCSKTLLFSDLSLQKKSSTSPLPLKEQEMDQGGSSLMGDLEFDFDRIHSEFHFPDLMDFDGLDCGNVTSLVSSNEILGELVPAQGNLDLNRPFTSCHHRGDDEDWLRDFTC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
40	Phosphorylation	THGEGKWSTLPNQAG HCCCCCCCCCCCHHH	24.45	24894044
41	Phosphorylation	HGEGKWSTLPNQAGL CCCCCCCCCCCHHHH	45.15	24894044
73	Phosphorylation	GIKRGNISSDEEELI CCCCCCCCCCHHHHH	35.42	19880383
152	Phosphorylation	KAIRCSKTLLFSDLS CEEECCCEEEECCCC	16.64	19880383
159	Phosphorylation	TLLFSDLSLQKKSST EEEECCCCCCCCCCC	33.47	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TT2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TT2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TT2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TT2_ARATH	TT2	physical	15255866
TT8_ARATH	TT8	physical	15255866
TTG1_ARATH	TTG1	physical	15255866

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TT2_ARATH

Related Literatures of Post-Translational Modification