UniProt ID | TSN1_SCHPO | |
---|---|---|
UniProt AC | Q9P7V3 | |
Protein Name | Translin-1 | |
Gene Name | tsn1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 220 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | DNA-binding protein that specifically recognizes consensus sequences at the breakpoint junctions in chromosomal translocations. Selectively binds single-stranded d(GT)n and d(GTT)n microsatellite repeats. Has much higher affinities for the homologous RNA sequences (GU)n and (GUU)n. Does not bind double-stranded DNA. Has a role in meiosis.. | |
Protein Sequence | MNKSIFIQLQDQIDKEHSIREKLTAEVDLLDEKLRVLQLLLANCEQNLENQEEILEALEIIKSKTRGLAELASNFPYYKYNGVWDRSIQKVVYLYLLASWTGRLDKSLRPTYSLLSLSEVGQILQVPVFPEESTFHLSIEQYLHAVLSLCSELARQSVNSVISGNYHIPFEALNTIQKVHSSFQVLSLKNDSLRRHFDGLKYDLKRSEDVVYDLRIHKLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of TSN1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TSN1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TSN1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TSN1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TSNAX_SCHPO | SPCC736.09c | physical | 20081200 | |
TSN1_SCHPO | tsn1 | physical | 20081200 | |
TSNAX_SCHPO | SPCC736.09c | physical | 24382491 | |
SRP1_SCHPO | srp1 | physical | 24382491 | |
VIPI_SCHPO | vip1 | physical | 24382491 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...