TSN1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TSN1_SCHPO
• UniProt AC: Q9P7V3
• Protein Name: Translin-1
• Gene Name: tsn1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 220
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: DNA-binding protein that specifically recognizes consensus sequences at the breakpoint junctions in chromosomal translocations. Selectively binds single-stranded d(GT)n and d(GTT)n microsatellite repeats. Has much higher affinities for the homologous RNA sequences (GU)n and (GUU)n. Does not bind double-stranded DNA. Has a role in meiosis..
• Protein Sequence: MNKSIFIQLQDQIDKEHSIREKLTAEVDLLDEKLRVLQLLLANCEQNLENQEEILEALEIIKSKTRGLAELASNFPYYKYNGVWDRSIQKVVYLYLLASWTGRLDKSLRPTYSLLSLSEVGQILQVPVFPEESTFHLSIEQYLHAVLSLCSELARQSVNSVISGNYHIPFEALNTIQKVHSSFQVLSLKNDSLRRHFDGLKYDLKRSEDVVYDLRIHKLV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TSN1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TSN1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TSN1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TSN1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TSNAX_SCHPO	SPCC736.09c	physical	20081200
TSN1_SCHPO	tsn1	physical	20081200
TSNAX_SCHPO	SPCC736.09c	physical	24382491
SRP1_SCHPO	srp1	physical	24382491
VIPI_SCHPO	vip1	physical	24382491

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.