UniProt ID | TSAP1_HUMAN | |
---|---|---|
UniProt AC | Q9NX07 | |
Protein Name | tRNA selenocysteine 1-associated protein 1 | |
Gene Name | TRNAU1AP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 287 | |
Subcellular Localization | Nucleus. Cytoplasm. Abundant in the nucleus.. | |
Protein Description | Involved in the early steps of selenocysteine biosynthesis and tRNA(Sec) charging to the later steps resulting in the cotranslational incorporation of selenocysteine into selenoproteins. Stabilizes the SECISBP2, EEFSEC and tRNA(Sec) complex. May be involved in the methylation of tRNA(Sec). Enhances efficiency of selenoproteins synthesis (By similarity).. | |
Protein Sequence | MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVSSEIPAMM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 (in isoform 2) | Ubiquitination | - | 34.98 | 21906983 | |
17 | Ubiquitination | LEPYMDENFISRAFA CHHHCCHHHHHHHHH | 34.98 | 22817900 | |
32 | Phosphorylation | TMGETVMSVKIIRNR HCCCCHHHHHHHHHC | 18.87 | 24719451 | |
41 (in isoform 2) | Ubiquitination | - | 29.81 | 21906983 | |
41 | Ubiquitination | KIIRNRLTGIPAGYC HHHHHCCCCCCCCEE | 29.81 | 22817900 | |
56 | Ubiquitination | FVEFADLATAEKCLH EEEHHHHHHHHHHHH | 12.81 | 24816145 | |
64 | Ubiquitination | TAEKCLHKINGKPLP HHHHHHHHHCCEECC | 25.56 | 29967540 | |
66 | Ubiquitination | EKCLHKINGKPLPGA HHHHHHHCCEECCCC | 58.18 | 27667366 | |
68 | Ubiquitination | CLHKINGKPLPGATP HHHHHCCEECCCCCC | 38.60 | 27667366 | |
74 | Phosphorylation | GKPLPGATPAKRFKL CEECCCCCCCCEEEE | 29.69 | 26055452 | |
77 | Ubiquitination | LPGATPAKRFKLNYA CCCCCCCCEEEEEEE | 60.62 | 27667366 | |
80 | Ubiquitination | ATPAKRFKLNYATYG CCCCCEEEEEEECCC | 39.60 | - | |
83 | Phosphorylation | AKRFKLNYATYGKQP CCEEEEEEECCCCCC | 15.68 | 28787133 | |
86 | Phosphorylation | FKLNYATYGKQPDNS EEEEEECCCCCCCCC | 17.72 | 28787133 | |
96 | Phosphorylation | QPDNSPEYSLFVGDL CCCCCCCEEEEEEEC | 17.66 | 28787133 | |
122 | Phosphorylation | FFVKVYPSCRGGKVV EEEEECCCCCCCEEE | 9.96 | 30631047 | |
124 | Methylation | VKVYPSCRGGKVVLD EEECCCCCCCEEEEC | 62.33 | 115919041 | |
127 | Ubiquitination | YPSCRGGKVVLDQTG CCCCCCCEEEECCCC | 31.81 | 21906983 | |
127 (in isoform 1) | Ubiquitination | - | 31.81 | 21906983 | |
137 | Ubiquitination | LDQTGVSKGYGFVKF ECCCCCCCCCCEEEE | 54.46 | 29967540 | |
143 | Ubiquitination | SKGYGFVKFTDELEQ CCCCCEEEECHHHHH | 40.04 | 29967540 | |
151 | Ubiquitination | FTDELEQKRALTECQ ECHHHHHHHHHHHCC | 30.20 | 22817900 | |
151 (in isoform 1) | Ubiquitination | - | 30.20 | 21906983 | |
165 | Phosphorylation | QGAVGLGSKPVRLSV CCCCCCCCCCEEEEE | 38.54 | 22210691 | |
166 | Ubiquitination | GAVGLGSKPVRLSVA CCCCCCCCCEEEEEE | 45.81 | 24816145 | |
176 | Ubiquitination | RLSVAIPKASRVKPV EEEEEECCCCCCCCC | 53.53 | 27667366 | |
261 | Phosphorylation | NKEFMEQSEELYDAL HHHHHHHHHHHHHHH | 21.52 | 25072903 | |
265 | Phosphorylation | MEQSEELYDALMDCH HHHHHHHHHHHHHCC | 11.49 | 25072903 | |
278 | Phosphorylation | CHWQPLDTVSSEIPA CCCCCCCCCCCCCCC | 29.94 | 25072903 | |
280 | Phosphorylation | WQPLDTVSSEIPAMM CCCCCCCCCCCCCCC | 25.09 | 25072903 | |
281 | Phosphorylation | QPLDTVSSEIPAMM- CCCCCCCCCCCCCC- | 34.90 | 25072903 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TSAP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TSAP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TSAP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LMNB2_HUMAN | LMNB2 | physical | 26186194 | |
PRP39_HUMAN | PRPF39 | physical | 26186194 | |
ZG16B_HUMAN | ZG16B | physical | 26186194 | |
PRP39_HUMAN | PRPF39 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...