UniProt ID | TRIA1_HUMAN | |
---|---|---|
UniProt AC | O43715 | |
Protein Name | TP53-regulated inhibitor of apoptosis 1 | |
Gene Name | TRIAP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 76 | |
Subcellular Localization | Cytoplasm, perinuclear region . Mitochondrion . Mitochondrion intermembrane space . | |
Protein Description | Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. [PubMed: 23931759 Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo)] | |
Protein Sequence | MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MNSVGEAC -------CCCHHHHH | 8.33 | 22814378 | |
9 | Phosphorylation | NSVGEACTDMKREYD CCHHHHHHHHHHHHH | 46.29 | 24043423 | |
12 | Acetylation | GEACTDMKREYDQCF HHHHHHHHHHHHHHH | 44.91 | 27452117 | |
21 | Methylation | EYDQCFNRWFAEKFL HHHHHHHHHHHHHHH | 15.05 | 115918945 | |
26 | Ubiquitination | FNRWFAEKFLKGDSS HHHHHHHHHHCCCCC | 53.20 | 22817900 | |
29 | Ubiquitination | WFAEKFLKGDSSGDP HHHHHHHCCCCCCCC | 64.90 | 22817900 | |
32 | Phosphorylation | EKFLKGDSSGDPCTD HHHHCCCCCCCCHHH | 44.91 | 25627689 | |
42 | Ubiquitination | DPCTDLFKRYQQCVQ CCHHHHHHHHHHHHH | 58.45 | 29967540 | |
42 | Acetylation | DPCTDLFKRYQQCVQ CCHHHHHHHHHHHHH | 58.45 | 26822725 | |
50 | Ubiquitination | RYQQCVQKAIKEKEI HHHHHHHHHHHHCCC | 31.51 | 29967540 | |
50 | Acetylation | RYQQCVQKAIKEKEI HHHHHHHHHHHHCCC | 31.51 | 26051181 | |
55 | Ubiquitination | VQKAIKEKEIPIEGL HHHHHHHCCCCCCCC | 56.81 | 29967540 | |
55 | Acetylation | VQKAIKEKEIPIEGL HHHHHHHCCCCCCCC | 56.81 | 25953088 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRIA1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRIA1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRIA1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HSP74_HUMAN | HSPA4 | physical | 15735003 | |
APAF_HUMAN | APAF1 | physical | 15735003 | |
PRLD1_HUMAN | PRELID1 | physical | 28514442 | |
PLD3B_HUMAN | SLMO2 | physical | 28514442 | |
PLD3A_HUMAN | SLMO1 | physical | 28514442 | |
IGJ_HUMAN | IGJ | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. |