TRI74_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRI74_HUMAN
• UniProt AC: Q86UV6
• Protein Name: Tripartite motif-containing protein 74
• Gene Name: TRIM74
• Organism: Homo sapiens (Human).
• Sequence Length: 250
• Protein Sequence: MAWQVSLLELEDWLQCPICLEVFKESLMLQCGHSYCKGCLVSLSYHLDTKVRCPMCWQVVDGSSSLPNVSLAWVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGSHQHHPVTPVSTVCSRMKEELAALFSELKQEQKKVDELIAKLVKNRTRIVNESDVFSWVIRREFQELRHPVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGTRERLAQAECVLEQFGNEDHHEFIWKFHSMASR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TRI74_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRI74_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRI74_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRI74_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BRCA1_HUMAN	BRCA1	physical	22493164
RNF32_HUMAN	RNF32	physical	22493164
CNOT1_HUMAN	CNOT1	physical	26186194
HEMH_HUMAN	FECH	physical	26186194
DTBP1_HUMAN	DTNBP1	physical	26186194
DTBP1_HUMAN	DTNBP1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.