UniProt ID | TR13C_HUMAN | |
---|---|---|
UniProt AC | Q96RJ3 | |
Protein Name | Tumor necrosis factor receptor superfamily member 13C | |
Gene Name | TNFRSF13C | |
Organism | Homo sapiens (Human). | |
Sequence Length | 184 | |
Subcellular Localization |
Membrane Single-pass type III membrane protein . |
|
Protein Description | B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response.. | |
Protein Sequence | MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MRRGPRSLRGRDAP -CCCCCCCCCCCCCC | 26.08 | - | |
17 | O-linked_Glycosylation | GRDAPAPTPCVPAEC CCCCCCCCCCCCHHH | 31.27 | OGP | |
40 | Phosphorylation | VACGLLRTPRPKPAG HHHCCCCCCCCCCCC | 24.50 | 28387310 | |
49 | Phosphorylation | RPKPAGASSPAPRTA CCCCCCCCCCCCCCC | 35.62 | 28387310 | |
50 | Phosphorylation | PKPAGASSPAPRTAL CCCCCCCCCCCCCCC | 25.25 | 30206219 | |
112 | Phosphorylation | QRRLRGASSAEAPDG HHHHCCCCCCCCCCC | 32.67 | 26657352 | |
113 | Phosphorylation | RRLRGASSAEAPDGD HHHCCCCCCCCCCCC | 29.60 | 30108239 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TR13C_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TR13C_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TR13C_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRAF1_HUMAN | TRAF1 | physical | 19698991 | |
TRAF3_HUMAN | TRAF3 | physical | 12471121 | |
TRAF3_HUMAN | TRAF3 | physical | 15585864 | |
TRAF2_HUMAN | TRAF2 | physical | 21041452 | |
TRAF3_HUMAN | TRAF3 | physical | 21041452 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...