| UniProt ID | TPSN_MOUSE | |
|---|---|---|
| UniProt AC | Q9R233 | |
| Protein Name | Tapasin | |
| Gene Name | Tapbp | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 465 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein . |
|
| Protein Description | Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading).. | |
| Protein Sequence | MKPLLLLVAVALGLATVVSVVSAGPEAIECWFVEDAGGGGLSKKPATLLLRHGPRGPPPRPDLDPKLYFKVDDPAGMLLAAFRRYPAGASAPHCEMSRFIPFPASAKWARSLSPEQNCPRALDGDWLLVSVSSTLFSLSSLLRPQPEPLREPVVITMATVVLTVLTHNPAPRVQLGKDAVLDLRFAYAPSALEGSPSLDAGPPPFGLEWRRQHRGKGHLLLAATPGLAGRMPPAQEKATAFAAWDDDEPWGPWTGNGTFWLPAVKPSQEGVYLATVHLPYLQGQVSLELTVHKAPRVSLTPAPVVWAAPGEAPPELLCLASHFFPAEGLEVKWELRGGPGGSSRKVEGKTWLSTIRHHSDGSVSQSGHLQLPPVTAKQHGVHYVCRVYHSSLPASGRSADVTLEVAGFSGPSIEDGIGLFLSAFLLLGLLKVLGWLAAYWTIPEVSKEKATAASLTIPRNSKKSQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 111 | Phosphorylation | ASAKWARSLSPEQNC CCHHHHHHCCCCCCC | 26.00 | 30635358 | |
| 113 | Phosphorylation | AKWARSLSPEQNCPR HHHHHHCCCCCCCCC | 27.86 | 30635358 | |
| 118 | Glutathionylation | SLSPEQNCPRALDGD HCCCCCCCCCCCCCC | 2.11 | 24333276 | |
| 177 | Ubiquitination | APRVQLGKDAVLDLR CCCCCCCCCCEEEEE | 51.62 | - | |
| 224 | Phosphorylation | GHLLLAATPGLAGRM CEEEEEECCCCCCCC | 16.57 | - | |
| 256 | N-linked_Glycosylation | PWGPWTGNGTFWLPA CCCCCCCCCEEEECC | 38.67 | - | |
| 449 | Ubiquitination | IPEVSKEKATAASLT CCHHCHHHCCCCCCC | 55.57 | - | |
| 451 | Phosphorylation | EVSKEKATAASLTIP HHCHHHCCCCCCCCC | 33.55 | 28059163 | |
| 454 | Phosphorylation | KEKATAASLTIPRNS HHHCCCCCCCCCCCC | 24.47 | 28833060 | |
| 456 | Phosphorylation | KATAASLTIPRNSKK HCCCCCCCCCCCCCC | 26.83 | 27180971 | |
| 461 | Phosphorylation | SLTIPRNSKKSQ--- CCCCCCCCCCCC--- | 42.62 | 25266776 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPSN_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPSN_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPSN_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TAP1_MOUSE | Tap1 | physical | 9973410 | |
| TAP2_MOUSE | Tap2 | physical | 9973410 | |
| HA11_MOUSE | H2-D1 | physical | 9973410 | |
| HA2B_MOUSE | H2-Aa | physical | 9973410 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...