UniProt ID | TPSN_MOUSE | |
---|---|---|
UniProt AC | Q9R233 | |
Protein Name | Tapasin | |
Gene Name | Tapbp | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 465 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein . |
|
Protein Description | Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading).. | |
Protein Sequence | MKPLLLLVAVALGLATVVSVVSAGPEAIECWFVEDAGGGGLSKKPATLLLRHGPRGPPPRPDLDPKLYFKVDDPAGMLLAAFRRYPAGASAPHCEMSRFIPFPASAKWARSLSPEQNCPRALDGDWLLVSVSSTLFSLSSLLRPQPEPLREPVVITMATVVLTVLTHNPAPRVQLGKDAVLDLRFAYAPSALEGSPSLDAGPPPFGLEWRRQHRGKGHLLLAATPGLAGRMPPAQEKATAFAAWDDDEPWGPWTGNGTFWLPAVKPSQEGVYLATVHLPYLQGQVSLELTVHKAPRVSLTPAPVVWAAPGEAPPELLCLASHFFPAEGLEVKWELRGGPGGSSRKVEGKTWLSTIRHHSDGSVSQSGHLQLPPVTAKQHGVHYVCRVYHSSLPASGRSADVTLEVAGFSGPSIEDGIGLFLSAFLLLGLLKVLGWLAAYWTIPEVSKEKATAASLTIPRNSKKSQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
111 | Phosphorylation | ASAKWARSLSPEQNC CCHHHHHHCCCCCCC | 26.00 | 30635358 | |
113 | Phosphorylation | AKWARSLSPEQNCPR HHHHHHCCCCCCCCC | 27.86 | 30635358 | |
118 | Glutathionylation | SLSPEQNCPRALDGD HCCCCCCCCCCCCCC | 2.11 | 24333276 | |
177 | Ubiquitination | APRVQLGKDAVLDLR CCCCCCCCCCEEEEE | 51.62 | - | |
224 | Phosphorylation | GHLLLAATPGLAGRM CEEEEEECCCCCCCC | 16.57 | - | |
256 | N-linked_Glycosylation | PWGPWTGNGTFWLPA CCCCCCCCCEEEECC | 38.67 | - | |
449 | Ubiquitination | IPEVSKEKATAASLT CCHHCHHHCCCCCCC | 55.57 | - | |
451 | Phosphorylation | EVSKEKATAASLTIP HHCHHHCCCCCCCCC | 33.55 | 28059163 | |
454 | Phosphorylation | KEKATAASLTIPRNS HHHCCCCCCCCCCCC | 24.47 | 28833060 | |
456 | Phosphorylation | KATAASLTIPRNSKK HCCCCCCCCCCCCCC | 26.83 | 27180971 | |
461 | Phosphorylation | SLTIPRNSKKSQ--- CCCCCCCCCCCC--- | 42.62 | 25266776 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPSN_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPSN_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPSN_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TAP1_MOUSE | Tap1 | physical | 9973410 | |
TAP2_MOUSE | Tap2 | physical | 9973410 | |
HA11_MOUSE | H2-D1 | physical | 9973410 | |
HA2B_MOUSE | H2-Aa | physical | 9973410 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...