| UniProt ID | HA11_MOUSE | |
|---|---|---|
| UniProt AC | P01899 | |
| Protein Name | H-2 class I histocompatibility antigen, D-B alpha chain | |
| Gene Name | H2-D1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 362 | |
| Subcellular Localization |
Membrane Single-pass type I membrane protein. |
|
| Protein Description | Involved in the presentation of foreign antigens to the immune system.. | |
| Protein Sequence | MGAMAPRTLLLLLAAALAPTQTRAGPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPPPSTDSYMVIVAVLGVLGAMAIIGAVVAFVMKRRRNTGGKGGDYALAPGSQSSEMSLRDCKA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 55 | Ubiquitination | SVGYVDNKEFVRFDS EEEEECCCEEEECCC | 48.33 | PubMed | |
| 62 | Phosphorylation | KEFVRFDSDAENPRY CEEEECCCCCCCCCC | 35.69 | 27841257 | |
| 92 | Ubiquitination | ERETQKAKGQEQWFR HHHHHHCCCCCHHHH | 69.07 | PubMed | |
| 110 | N-linked_Glycosylation | RNLLGYYNQSAGGSH HHHHHCCCCCCCCCC | 22.35 | 7118212 | |
| 155 | Ubiquitination | IALNEDLKTWTAADM EEECCCHHHHHHHHH | 55.10 | PubMed | |
| 170 | Ubiquitination | AAQITRRKWEQSGAA HHHHHHHHHHHCCHH | 52.36 | PubMed | |
| 188 | Glutathionylation | KAYLEGECVEWLHRY HHHHHCHHHHHHHHH | 5.03 | 24333276 | |
| 197 | Ubiquitination | EWLHRYLKNGNATLL HHHHHHHHCCCEEEE | 54.60 | PubMed | |
| 200 | N-linked_Glycosylation | HRYLKNGNATLLRTD HHHHHCCCEEEEECC | 38.86 | - | |
| 210 | Ubiquitination | LLRTDSPKAHVTHHP EEECCCCCCCCCCCC | 55.89 | PubMed | |
| 220 | Ubiquitination | VTHHPRSKGEVTLRC CCCCCCCCCCEEEEE | 61.44 | PubMed | |
| 267 | Ubiquitination | AGDGTFQKWASVVVP CCCCCHHCEEEEEEE | 40.30 | PubMed | |
| 277 | Ubiquitination | SVVVPLGKEQNYTCR EEEEECCCCCCEEEE | 64.90 | PubMed | |
| 280 | N-linked_Glycosylation | VPLGKEQNYTCRVYH EECCCCCCEEEEEEE | 34.86 | 3980466 | |
| 332 | Ubiquitination | AVVAFVMKRRRNTGG HHHHHHHHHCCCCCC | 37.13 | 17502423PubMed | |
| 340 | Ubiquitination | RRRNTGGKGGDYALA HCCCCCCCCCCCCCC | 62.15 | 17502423PubMed | |
| 350 | Phosphorylation | DYALAPGSQSSEMSL CCCCCCCCCCCCCCH | 26.32 | 24719451 | |
| 353 | Phosphorylation | LAPGSQSSEMSLRDC CCCCCCCCCCCHHHC | 29.67 | - | |
| 356 | Phosphorylation | GSQSSEMSLRDCKA- CCCCCCCCHHHCCC- | 19.05 | 24719451 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HA11_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HA11_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HA11_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Primary structure of the H-2Db alloantigen. II. Additional amino acidsequence information, localization of a third site of glycosylationand evidence for K and D region specific sequences."; Maloy W.L., Coligan J.E.; Immunogenetics 16:11-22(1982). Cited for: PROTEIN SEQUENCE OF 253-308 AND 332-358. | |