UniProt ID | HA11_MOUSE | |
---|---|---|
UniProt AC | P01899 | |
Protein Name | H-2 class I histocompatibility antigen, D-B alpha chain | |
Gene Name | H2-D1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 362 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein. |
|
Protein Description | Involved in the presentation of foreign antigens to the immune system.. | |
Protein Sequence | MGAMAPRTLLLLLAAALAPTQTRAGPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPPPSTDSYMVIVAVLGVLGAMAIIGAVVAFVMKRRRNTGGKGGDYALAPGSQSSEMSLRDCKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
55 | Ubiquitination | SVGYVDNKEFVRFDS EEEEECCCEEEECCC | 48.33 | PubMed | |
62 | Phosphorylation | KEFVRFDSDAENPRY CEEEECCCCCCCCCC | 35.69 | 27841257 | |
92 | Ubiquitination | ERETQKAKGQEQWFR HHHHHHCCCCCHHHH | 69.07 | PubMed | |
110 | N-linked_Glycosylation | RNLLGYYNQSAGGSH HHHHHCCCCCCCCCC | 22.35 | 7118212 | |
155 | Ubiquitination | IALNEDLKTWTAADM EEECCCHHHHHHHHH | 55.10 | PubMed | |
170 | Ubiquitination | AAQITRRKWEQSGAA HHHHHHHHHHHCCHH | 52.36 | PubMed | |
188 | Glutathionylation | KAYLEGECVEWLHRY HHHHHCHHHHHHHHH | 5.03 | 24333276 | |
197 | Ubiquitination | EWLHRYLKNGNATLL HHHHHHHHCCCEEEE | 54.60 | PubMed | |
200 | N-linked_Glycosylation | HRYLKNGNATLLRTD HHHHHCCCEEEEECC | 38.86 | - | |
210 | Ubiquitination | LLRTDSPKAHVTHHP EEECCCCCCCCCCCC | 55.89 | PubMed | |
220 | Ubiquitination | VTHHPRSKGEVTLRC CCCCCCCCCCEEEEE | 61.44 | PubMed | |
267 | Ubiquitination | AGDGTFQKWASVVVP CCCCCHHCEEEEEEE | 40.30 | PubMed | |
277 | Ubiquitination | SVVVPLGKEQNYTCR EEEEECCCCCCEEEE | 64.90 | PubMed | |
280 | N-linked_Glycosylation | VPLGKEQNYTCRVYH EECCCCCCEEEEEEE | 34.86 | 3980466 | |
332 | Ubiquitination | AVVAFVMKRRRNTGG HHHHHHHHHCCCCCC | 37.13 | 17502423PubMed | |
340 | Ubiquitination | RRRNTGGKGGDYALA HCCCCCCCCCCCCCC | 62.15 | 17502423PubMed | |
350 | Phosphorylation | DYALAPGSQSSEMSL CCCCCCCCCCCCCCH | 26.32 | 24719451 | |
353 | Phosphorylation | LAPGSQSSEMSLRDC CCCCCCCCCCCHHHC | 29.67 | - | |
356 | Phosphorylation | GSQSSEMSLRDCKA- CCCCCCCCHHHCCC- | 19.05 | 24719451 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HA11_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HA11_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HA11_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Primary structure of the H-2Db alloantigen. II. Additional amino acidsequence information, localization of a third site of glycosylationand evidence for K and D region specific sequences."; Maloy W.L., Coligan J.E.; Immunogenetics 16:11-22(1982). Cited for: PROTEIN SEQUENCE OF 253-308 AND 332-358. |