dbPTM

TOC33_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TOC33_ARATH
UniProt AC	O23680
Protein Name	Translocase of chloroplast 33, chloroplastic
Gene Name	TOC33
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	297
Subcellular Localization	Plastid, chloroplast outer membrane Single-pass membrane protein . May contain beta barrel transmembrane regions.
Protein Description	GTPase involved in protein precursor import into chloroplasts. Seems to recognize chloroplast-destined precursor proteins and regulate their presentation to the translocation channel through GTP hydrolysis. Binds GTP, GDP, XTP, but not ATP. Probably specialized in the import of nuclear encoded photosynthetic preproteins from the cytoplasm to the chloroplast, especially during early development stages..
Protein Sequence	MGSLVREWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFQAEGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSDSLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDVATNQRKAIHVDKKMVDGSYSDDKGKKLIPLIIGAQYLIVKMIQGAIRNDIKTSGKPL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
122	Phosphorylation	RTIDVLLYVDRLDVY CEEEEEEEEECCCEE	8.99	24243849
181	Phosphorylation	FSSKRSDSLLKTIRA HCCCCCHHHHHHHHH	36.53	17337454

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TOC33_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
181	S	Phosphorylation		12741849
When Ser-181 is phosphorylated, the binding to preprotein, GTP and GDP is inhibited, and thus, GTPase activity is repressed.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TOC33_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TI110_ARATH	TIC110	physical	15829604
TC159_ARATH	TOC159	physical	15829604
AKR2A_ARATH	AKR2	physical	18193034
TOC33_ARATH	TOC33	physical	18541539
TOC33_ARATH	TOC33	physical	19001421
TOC33_ARATH	TOC33	physical	19744928
TOC33_ARATH	TOC33	physical	21434866
TC159_ARATH	TOC159	physical	12951325
TC159_ARATH	TOC159	physical	12473690

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TOC33_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phospho-mimicry mutant of atToc33 affects early development ofArabidopsis thaliana."; Oreb M., Zoryan M., Vojta A., Maier U.G., Eichacker L.A., Schleiff E.; FEBS Lett. 581:5945-5951(2007). Cited for: FUNCTION, AND PHOSPHORYLATION AT SER-181.	18054337 [Abstract]
"In vivo assessment of the significance of phosphorylation of theArabidopsis chloroplast protein import receptor, atToc33."; Aronsson H., Combe J., Patel R., Jarvis P.; FEBS Lett. 580:649-655(2006). Cited for: FUNCTION, PHOSPHORYLATION AT SER-181, AND MUTAGENESIS OF SER-181.	16412428 [Abstract]
"Two Toc34 homologues with different properties."; Jelic M., Soll J., Schleiff E.; Biochemistry 42:5906-5916(2003). Cited for: FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHORYLATION AT SER-181,DIMERIZATION WITH TOC34, AND MUTAGENESIS OF SER-170; SER-175; SER-181;SER-190 AND SER-200.	12741849 [Abstract]