TNR12_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TNR12_HUMAN
• UniProt AC: Q9NP84
• Protein Name: Tumor necrosis factor receptor superfamily member 12A
• Gene Name: TNFRSF12A
• Organism: Homo sapiens (Human).
• Sequence Length: 129
• Subcellular Localization: Membrane; Single-pass type I membrane protein.
• Protein Description: Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins..
• Protein Sequence: MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Phosphorylation	APCSRGSSWSADLDK CCCCCCCCCCCCHHH	28.07	25627689
109	Ubiquitination	RRCRRREKFTTPIEE HHHHCCCCCCCCCHH	46.31	21963094
111	Phosphorylation	CRRREKFTTPIEETG HHCCCCCCCCCHHHC	42.61	29514088
112	Phosphorylation	RRREKFTTPIEETGG HCCCCCCCCCHHHCC	25.96	29514088
117	Phosphorylation	FTTPIEETGGEGCPA CCCCCHHHCCCCCCC	37.38	29514088

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TNR12_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TNR12_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TNR12_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRAF1_HUMAN	TRAF1	physical	11728344
TRAF2_HUMAN	TRAF2	physical	11728344
BIRC2_HUMAN	BIRC2	physical	21525013

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.