UniProt ID | TNF12_HUMAN | |
---|---|---|
UniProt AC | O43508 | |
Protein Name | Tumor necrosis factor ligand superfamily member 12 | |
Gene Name | TNFSF12 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 249 | |
Subcellular Localization |
Cell membrane Single-pass type II membrane protein . Tumor necrosis factor ligand superfamily member 12, secreted form: Secreted. Isoform TWE-PRIL: Cell membrane Single-pass membrane protein. |
|
Protein Description | Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Promotes IL8 secretion.. | |
Protein Sequence | MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
139 | N-linked_Glycosylation | GWEEARINSSSPLRY CCCCCCCCCCCCCCC | 30.22 | UniProtKB CARBOHYD | |
198 | O-linked_Glycosylation | CLEEFSATAASSLGP HHHHHCCHHHHHCCH | 22.89 | OGP | |
213 | Phosphorylation | QLRLCQVSGLLALRP HHHEEEECCEEEECC | 9.61 | - | |
222 | Phosphorylation | LLALRPGSSLRIRTL EEEECCCCCCEEEEC | 28.96 | 23312004 | |
223 | Phosphorylation | LALRPGSSLRIRTLP EEECCCCCCEEEECC | 27.81 | 23312004 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNF12_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNF12_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNF12_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
OTUB1_HUMAN | OTUB1 | physical | 23524849 | |
BIRC2_HUMAN | BIRC2 | physical | 23524849 | |
TRAF2_HUMAN | TRAF2 | physical | 23524849 | |
TN13B_HUMAN | TNFSF13B | physical | 23493554 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...