UniProt ID | THAP2_HUMAN | |
---|---|---|
UniProt AC | Q9H0W7 | |
Protein Name | THAP domain-containing protein 2 | |
Gene Name | THAP2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 228 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHTFLCSKHFEASCFDLTGQTRRLKMDAVPTIFDFCTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLEDFKILEQDQQDKTLLSLNLKQTKSTFI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
104 | Phosphorylation | LKKNNSCSPAGPSNL HHHCCCCCCCCCCHH | 20.01 | 22985185 | |
143 | Ubiquitination | KRIIKLEKEIASLRR HHHHHHHHHHHHHHH | 65.93 | 2097226 | |
158 | Ubiquitination | KMKTCLQKERRATRR HHHHHHHHHHHHHHH | 39.99 | - | |
168 | Sumoylation | RATRRWIKATCLVKN HHHHHHHHHHHHHCC | 30.59 | - | |
174 | Sumoylation | IKATCLVKNLEANSV HHHHHHHCCCCCCCC | 42.75 | - | |
180 | Phosphorylation | VKNLEANSVLPKGTS HCCCCCCCCCCCCCC | 31.89 | - | |
193 | Phosphorylation | TSEHMLPTALSSLPL CCCCCCCCHHHCCCH | 35.95 | 18452278 | |
196 | Phosphorylation | HMLPTALSSLPLEDF CCCCCHHHCCCHHHH | 27.62 | 18452278 | |
217 | Phosphorylation | QQDKTLLSLNLKQTK HHCCCEEEEECCHHC | 20.51 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THAP2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THAP2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THAP2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VANG1_HUMAN | VANGL1 | physical | 21988832 | |
HCFC1_HUMAN | HCFC1 | physical | 26186194 | |
HCFC2_HUMAN | HCFC2 | physical | 26186194 | |
CTBL1_HUMAN | CTNNBL1 | physical | 26186194 | |
LIN41_HUMAN | TRIM71 | physical | 26186194 | |
DNJB8_HUMAN | DNAJB8 | physical | 26186194 | |
CTBL1_HUMAN | CTNNBL1 | physical | 28514442 | |
LIN41_HUMAN | TRIM71 | physical | 28514442 | |
DNJB8_HUMAN | DNAJB8 | physical | 28514442 | |
HCFC2_HUMAN | HCFC2 | physical | 28514442 | |
OGT1_HUMAN | OGT | physical | 28514442 | |
HCFC1_HUMAN | HCFC1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...