| UniProt ID | THAP2_HUMAN | |
|---|---|---|
| UniProt AC | Q9H0W7 | |
| Protein Name | THAP domain-containing protein 2 | |
| Gene Name | THAP2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 228 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHTFLCSKHFEASCFDLTGQTRRLKMDAVPTIFDFCTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLEDFKILEQDQQDKTLLSLNLKQTKSTFI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 104 | Phosphorylation | LKKNNSCSPAGPSNL HHHCCCCCCCCCCHH | 20.01 | 22985185 | |
| 143 | Ubiquitination | KRIIKLEKEIASLRR HHHHHHHHHHHHHHH | 65.93 | 2097226 | |
| 158 | Ubiquitination | KMKTCLQKERRATRR HHHHHHHHHHHHHHH | 39.99 | - | |
| 168 | Sumoylation | RATRRWIKATCLVKN HHHHHHHHHHHHHCC | 30.59 | - | |
| 174 | Sumoylation | IKATCLVKNLEANSV HHHHHHHCCCCCCCC | 42.75 | - | |
| 180 | Phosphorylation | VKNLEANSVLPKGTS HCCCCCCCCCCCCCC | 31.89 | - | |
| 193 | Phosphorylation | TSEHMLPTALSSLPL CCCCCCCCHHHCCCH | 35.95 | 18452278 | |
| 196 | Phosphorylation | HMLPTALSSLPLEDF CCCCCHHHCCCHHHH | 27.62 | 18452278 | |
| 217 | Phosphorylation | QQDKTLLSLNLKQTK HHCCCEEEEECCHHC | 20.51 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THAP2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THAP2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THAP2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VANG1_HUMAN | VANGL1 | physical | 21988832 | |
| HCFC1_HUMAN | HCFC1 | physical | 26186194 | |
| HCFC2_HUMAN | HCFC2 | physical | 26186194 | |
| CTBL1_HUMAN | CTNNBL1 | physical | 26186194 | |
| LIN41_HUMAN | TRIM71 | physical | 26186194 | |
| DNJB8_HUMAN | DNAJB8 | physical | 26186194 | |
| CTBL1_HUMAN | CTNNBL1 | physical | 28514442 | |
| LIN41_HUMAN | TRIM71 | physical | 28514442 | |
| DNJB8_HUMAN | DNAJB8 | physical | 28514442 | |
| HCFC2_HUMAN | HCFC2 | physical | 28514442 | |
| OGT1_HUMAN | OGT | physical | 28514442 | |
| HCFC1_HUMAN | HCFC1 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...