TGIF1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TGIF1_MOUSE
• UniProt AC: P70284
• Protein Name: Homeobox protein TGIF1
• Gene Name: Tgif1
• Organism: Mus musculus (Mouse).
• Sequence Length: 272
• Subcellular Localization: Nucleus.
• Protein Description: Binds to a retinoid X receptor (RXR) responsive element from the cellular retinol-binding protein II promoter (CRBPII-RXRE). Inhibits the 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element. May participate in the transmission of nuclear signals during development and in the adult, as illustrated by the down-modulation of the RXR alpha activities (By similarity)..
• Protein Sequence: MKSKKGLVAASGSDSEDEDSMDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGSILARPSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	KKGLVAASGSDSEDE CCCCEECCCCCCCCC	29.14	25619855
13	Phosphorylation	GLVAASGSDSEDEDS CCEECCCCCCCCCCC	35.15	25619855
15	Phosphorylation	VAASGSDSEDEDSMD EECCCCCCCCCCCCC	48.95	25619855
20	Phosphorylation	SDSEDEDSMDSPLDL CCCCCCCCCCCCCCC	23.57	25619855
23	Phosphorylation	EDEDSMDSPLDLSSS CCCCCCCCCCCCCCH	20.79	23984901
28	Phosphorylation	MDSPLDLSSSAASGK CCCCCCCCCHHHHCC	23.16	21149613
29	Phosphorylation	DSPLDLSSSAASGKR CCCCCCCCHHHHCCC	31.15	21149613
30	Phosphorylation	SPLDLSSSAASGKRR CCCCCCCHHHHCCCH	25.20	21149613
33	Phosphorylation	DLSSSAASGKRRRRG CCCCHHHHCCCHHCC	44.56	21149613
143	Phosphorylation	LEESPFHSCVVGPNP CCCCCCCCEEECCCC	14.69	26160508
151	Phosphorylation	CVVGPNPTLGRPVSP EEECCCCCCCCCCCC	48.78	26160508
157	Phosphorylation	PTLGRPVSPKPPSPG CCCCCCCCCCCCCCC	29.86	21149613
162	Phosphorylation	PVSPKPPSPGSILAR CCCCCCCCCCCCCCC	50.88	21149613
165	Phosphorylation	PKPPSPGSILARPSV CCCCCCCCCCCCCCE	20.15	26160508
259	Ubiquitination	LLVDVALKRAAEMEL HHHHHHHHHHHHHHH	30.19	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TGIF1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TGIF1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TGIF1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RXRA_MOUSE	Rxra	physical	16428452
RARA_MOUSE	Rara	physical	16428452
PPARG_MOUSE	Pparg	physical	16428452
RXRB_MOUSE	Rxrb	physical	16428452
RXRG_MOUSE	Rxrg	physical	16428452

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.