| UniProt ID | TEN1_YEAST | |
|---|---|---|
| UniProt AC | Q07921 | |
| Protein Name | Telomere length regulation protein TEN1 | |
| Gene Name | TEN1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 160 | |
| Subcellular Localization | Nucleus . Chromosome, telomere . | |
| Protein Description | Has a role in telomere length regulation and telomere end protection. Acts as an inhibitor of telomerase loading through its interaction with CDC13.. | |
| Protein Sequence | MSQLVLDLKCLKDKIATNYDIHNNVYGGNGMEPNIIHPSKRFRIVVRLVDFLFCKSDEEFIKGFFCQMIVRNLHCLNSTNGAEEMRLYMSERLFSAHKDDLRLINGQVLDVRIGVWYGIHQSPPIFEIIDFKILSRNDVRDFCEFVKSPLGEKFLNISNS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of TEN1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TEN1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TEN1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TEN1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| STN1_YEAST | STN1 | physical | 11230140 | |
| CDC13_YEAST | CDC13 | physical | 11230140 | |
| STN1_YEAST | STN1 | physical | 18719252 | |
| CDC13_YEAST | CDC13 | physical | 19532124 | |
| STN1_YEAST | STN1 | physical | 19532124 | |
| CDC13_YEAST | CDC13 | physical | 19752213 | |
| STN1_YEAST | STN1 | physical | 19752213 | |
| CDC13_YEAST | CDC13 | genetic | 19752213 | |
| TERT_YEAST | EST2 | genetic | 19752213 | |
| EXO1_YEAST | EXO1 | genetic | 19752213 | |
| STN1_YEAST | STN1 | physical | 20157006 | |
| STN1_YEAST | STN1 | physical | 20576529 | |
| STN1_YEAST | STN1 | physical | 19172739 | |
| RAD24_YEAST | RAD24 | genetic | 22377634 | |
| STN1_YEAST | STN1 | physical | 24164896 | |
| CDC13_YEAST | CDC13 | physical | 24164896 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
