UniProt ID | TDG_MOUSE | |
---|---|---|
UniProt AC | P56581 | |
Protein Name | G/T mismatch-specific thymine DNA glycosylase | |
Gene Name | Tdg | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 421 | |
Subcellular Localization | Nucleus. | |
Protein Description | DNA glycosylase that plays a key role in active DNA demethylation: specifically recognizes and binds 5-formylcytosine (5fC) and 5-carboxylcytosine (5caC) in the context of CpG sites and mediates their excision through base-excision repair (BER) to install an unmethylated cytosine. [PubMed: 21817016 Cannot remove 5-hydroxymethylcytosine (5hmC According to an alternative model, involved in DNA demethylation by mediating DNA glycolase activity toward 5-hydroxymethyluracil (5hmU) produced by deamination of 5hmC] | |
Protein Sequence | MDAEAARSYSLEQVQALYSFPFQQMMAEVPNMAVTTGQQVPAVAPNMATVTEQQVPEDAPVQEPAPEAPKRRKRKPRAAEPQEPVEPKKPATSKKSGKSTKSKEKQEKITDAFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNADVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCNGEPCGIASNGLTAHSAEPRGEAAPSDVPNGQWMAQSFAEQIPSFNNCGTREQEEESHA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
70 | Acetylation | EPAPEAPKRRKRKPR CCCCCCCHHHCCCCC | 46.75 | 11864601 | |
94 | Acetylation | PKKPATSKKSGKSTK CCCCCCCCCCCCCCC | 42.65 | 11864601 | |
95 | Acetylation | KKPATSKKSGKSTKS CCCCCCCCCCCCCCC | 8.09 | 11864601 | |
96 | Phosphorylation | KPATSKKSGKSTKSK CCCCCCCCCCCCCCH | 53.11 | - | |
98 | Acetylation | ATSKKSGKSTKSKEK CCCCCCCCCCCCHHH | 8.92 | 11864601 | |
99 | Phosphorylation | TSKKSGKSTKSKEKQ CCCCCCCCCCCHHHH | 51.34 | - | |
212 | Malonylation | ERTTPGSKDLSSKEF EECCCCCCCCCCHHH | 17.61 | 26320211 | |
341 | Sumoylation | DAKKMAVKEEKYDPG HHHHHHHHHHHCCCC | 24.35 | - |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
341 | K | Sumoylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TDG_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DNM3A_HUMAN | DNMT3A | physical | 17175537 | |
AICDA_MOUSE | Aicda | physical | 21722948 | |
GA45A_MOUSE | Gadd45a | physical | 21722948 | |
LEF1_MOUSE | Lef1 | physical | 24748645 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...