GA45A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GA45A_MOUSE
• UniProt AC: P48316
• Protein Name: Growth arrest and DNA damage-inducible protein GADD45 alpha
• Gene Name: Gadd45a
• Organism: Mus musculus (Mouse).
• Sequence Length: 165
• Subcellular Localization: Nucleus.
• Protein Description: Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity..
• Protein Sequence: MTLEEFSAAEQKTERMDTVGDALEEVLSKARSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIRAFCCENDINILRVSNPGRLAELLLLENDAGPAESGGAAQTPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTLEEFSAA ------CCHHHHHHH	42.76	-
41	Phosphorylation	RTITVGVYEAAKLLN CEEEEEHHHHHHHCC	8.23	30482847

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GA45A_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GA45A_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GA45A_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TDG_MOUSE	Tdg	physical	21722948
APEX1_MOUSE	Apex1	physical	17599061
PCNA_MOUSE	Pcna	physical	17599061
SMAD4_MOUSE	Smad4	physical	26022109
FBW1A_MOUSE	Btrc	physical	26022109

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.