AICDA_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AICDA_MOUSE
• UniProt AC: Q9WVE0
• Protein Name: Single-stranded DNA cytosine deaminase
• Gene Name: Aicda
• Organism: Mus musculus (Mouse).
• Sequence Length: 198
• Subcellular Localization: Nucleus . Cytoplasm . Predominantly cytoplasmic but shuttles between the nucleus and the cytoplasm.
• Protein Description: Single-stranded DNA-specific cytidine deaminase. Involved in somatic hypermutation (SHM), gene conversion, and class-switch recombination (CSR) in B-lymphocytes by deaminating C to U during transcription of Ig-variable (V) and Ig-switch (S) region DNA. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation..
• Protein Sequence: MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MDSLLMKQKK -----CCCHHHHCHH	23.31	21135131
27	Phosphorylation	WAKGRHETYLCYVVK CCCCCCCEEEEEEEE	18.70	114757
38	Phosphorylation	YVVKRRDSATSCSLD EEEECCCCCCEEEEE	31.47	18838546
41	Phosphorylation	KRRDSATSCSLDFGH ECCCCCCEEEEECCC	11.04	8511005
140	Phosphorylation	GVQIGIMTFKDYFYC CCEEEEEEEHHHEEH	26.13	18838546
184	Phosphorylation	RRILLPLYEVDDLRD HHHHHHHCCCCCHHH	16.39	2321799

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
3	S	Phosphorylation	Kinase	PRKCZ	Q05513	GPS
3	S	Phosphorylation	Kinase	PRKCA	P17252	GPS
3	S	Phosphorylation	Kinase	PRKCQ	Q04759	GPS
3	S	Phosphorylation	Kinase	PRKCB	P05771	GPS
3	S	Phosphorylation	Kinase	PKCB ISO2	P05771-2	PSP
3	S	Phosphorylation	Kinase	PRKCD	Q05655	GPS
3	S	Phosphorylation	Kinase	PRKCE	Q02156	GPS
3	S	Phosphorylation	Kinase	PRKCG	P05129	GPS
3	S	Phosphorylation	Kinase	PRKCI	P41743	GPS
27	T	Phosphorylation	Kinase	PRKACA	P17612	GPS
27	T	Phosphorylation	Kinase	PKA	-	Uniprot
38	S	Phosphorylation	Kinase	PKA-FAMILY	-	GPS
38	S	Phosphorylation	Kinase	PRKACA	P17612	GPS
38	S	Phosphorylation	Kinase	PKA	-	Uniprot
140	T	Phosphorylation	Kinase	PRKCI	P41743	GPS
140	T	Phosphorylation	Kinase	PRKCH	P24723	GPS
140	T	Phosphorylation	Kinase	PRKCB	P05771	GPS
140	T	Phosphorylation	Kinase	PRKCA	P17252	GPS

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
27	T	Phosphorylation	Ser-38 is the major site whereas Thr-27 is the minor site of phosphorylation.	-
38	S	Phosphorylation	Ser-38 is the major site whereas Thr-27 is the minor site of phosphorylation.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AICDA_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TDG_MOUSE	Tdg	physical	21722948
GA45A_MOUSE	Gadd45a	physical	21722948
NEDD4_MOUSE	Nedd4	physical	23964096
EXOS3_MOUSE	Exosc3	physical	23964096
SPT5H_MOUSE	Supt5	physical	23964096

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.