UniProt ID | TBPL2_HUMAN | |
---|---|---|
UniProt AC | Q6SJ96 | |
Protein Name | TATA box-binding protein-like protein 2 | |
Gene Name | TBPL2 {ECO:0000312|EMBL:AAI17186.1, ECO:0000312|HGNC:HGNC:19841} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 375 | |
Subcellular Localization | Cytoplasm . Nucleus . Present in the cytoplasm during cytokinesis. | |
Protein Description | Transcription factor required in complex with TAF3 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process (By similarity).. | |
Protein Sequence | MASAPWPERVPRLLAPRLPSYPPPPPTVGLRSMEQEETYLELYLDQCAAQDGLAPPRSPLFSPVVPYDMYILNASNPDTAFNSNPEVKETSGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQDVGLGLNSSSLSNSHSQLHPGDTDSVQPSPEKPNSDSLSLASITPMTPMTPISECCGIVPQLQNIVSTVNLACKLDLKKIALHAKNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGFKKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | LAPRLPSYPPPPPTV HCCCCCCCCCCCCCC | 20.16 | 22468782 | |
27 | Phosphorylation | SYPPPPPTVGLRSME CCCCCCCCCCCCCCC | 32.74 | 22468782 | |
232 | Ubiquitination | KNAEYNPKRFAAVIM HCCCCCHHHHEEHHH | 57.41 | 24816145 | |
262 | Ubiquitination | KMVCTGAKSEEQSRL CEEECCCCCHHHHHH | 60.80 | 29967540 | |
267 | Phosphorylation | GAKSEEQSRLAARKY CCCCHHHHHHHHHHH | 32.32 | - | |
274 | Phosphorylation | SRLAARKYARVVQKL HHHHHHHHHHHHHHH | 8.29 | - | |
280 | Ubiquitination | KYARVVQKLGFPARF HHHHHHHHHCCCHHH | 38.68 | 22817900 | |
344 | Phosphorylation | IVLLIFVSGKVVLTG EEEEEEECCEEEEEC | 23.34 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBPL2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBPL2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBPL2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NFYC_HUMAN | NFYC | physical | 19351825 | |
DNJB5_HUMAN | DNAJB5 | physical | 18555775 | |
IMA1_HUMAN | KPNA2 | physical | 15234975 | |
M4K4_HUMAN | MAP4K4 | physical | 15234975 | |
DNJB4_HUMAN | DNAJB4 | physical | 15234975 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...