TBCC_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TBCC_SCHPO
• UniProt AC: Q9P3T8
• Protein Name: Tubulin-specific chaperone C
• Gene Name: cin2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 259
• Subcellular Localization: Cytoplasm, cytoskeleton .
• Protein Description: Tubulin-folding protein; involved in the final step of the tubulin folding pathway..
• Protein Sequence: MSEKFVELRKEFLTKLYKSTPSEQTSRSEKETWLEEKSKYLGEMTRELNEVQDQIAPYDRRVCMEQLVDLTRRLQQIRHDILPRQPFRFQRALHVKSSQKPVKNITVNAEAPEVYFENDTLYLANLKNQNIGDNVIPYPNNKAVKVSAKSLRSCNISISNCSSVNLHNATKCNFTFPTIQGSIHLSDINDSTICVSCHQFRLHHSTNLRVHLRCKTSPVIEESKEISFSYKDEHPILDFTWARSDPSPHFRITSDLFDA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TBCC_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TBCC_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TBCC_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TBCC_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARL_SCHPO	alp41	physical	23576550
ARL_SCHPO	alp41	genetic	23576550
ALP1_SCHPO	alp1	genetic	23576550
TEA3_SCHPO	tea3	physical	26771498
NMAH_SCHPO	SPAC806.06c	physical	26771498
YH7G_SCHPO	SPBC16G5.16	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.