| UniProt ID | T2AG_HUMAN | |
|---|---|---|
| UniProt AC | P52657 | |
| Protein Name | Transcription initiation factor IIA subunit 2 | |
| Gene Name | GTF2A2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 109 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.. | |
| Protein Sequence | MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 61 | Phosphorylation | NRVNFRGSLNTYRFC HCCCCCCCCCHHEEC | 17.75 | 29523821 | |
| 64 | Phosphorylation | NFRGSLNTYRFCDNV CCCCCCCHHEECCCE | 22.74 | 29523821 | |
| 89 | Ubiquitination | REVTELIKVDKVKIV HHHHHEEEECEEEEE | 57.94 | - | |
| 94 | Ubiquitination | LIKVDKVKIVACDGK EEEECEEEEEEECCC | 36.88 | - | |
| 98 | S-nitrosocysteine | DKVKIVACDGKNTGS CEEEEEEECCCCCCC | 4.99 | - | |
| 98 | S-nitrosylation | DKVKIVACDGKNTGS CEEEEEEECCCCCCC | 4.99 | 19483679 | |
| 101 | Ubiquitination | KIVACDGKNTGSNTT EEEEECCCCCCCCCC | 37.78 | 21906983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of T2AG_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of T2AG_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of T2AG_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TBP_HUMAN | TBP | physical | 7724559 | |
| TAF4_HUMAN | TAF4 | physical | 11564872 | |
| TBP_HUMAN | TBP | physical | 8626665 | |
| T2AG_HUMAN | GTF2A2 | physical | 8626665 | |
| TF2AA_HUMAN | GTF2A1 | physical | 8626665 | |
| TBP_HUMAN | TBP | physical | 29111974 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
