UniProt ID | SYPH_RAT | |
---|---|---|
UniProt AC | P07825 | |
Protein Name | Synaptophysin | |
Gene Name | Syp | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 307 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Multi-pass membrane protein . Cell junction, synapse, synaptosome . |
|
Protein Description | Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity (By similarity).. | |
Protein Sequence | MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
53 | N-linked_Glycosylation | RLSVECANKTESALN EEEEEECCCCCCCEE | 64.54 | - | |
75 | Phosphorylation | PFRLHQVYFDAPSCV CEEEEEEEECCCCCC | 6.81 | 30411139 | |
163 | Acetylation | AKGLSDVKMATDPEN HCCCCCCEECCCHHH | 28.01 | 22902405 | |
184 | Phosphorylation | MCRQTGNTCKELRDP CCCCCCCCHHHHCCC | 26.71 | 25403869 | |
221 | Phosphorylation | LWFVFKETGWAAPFM HHHHHHCCCCCCCCC | 38.32 | - | |
263 | Phosphorylation | GYGPQDSYGPQGGYQ CCCCCCCCCCCCCCC | 40.91 | - | |
273 | Phosphorylation | QGGYQPDYGQPASGG CCCCCCCCCCCCCCC | 25.09 | - | |
289 | Phosphorylation | GYGPQGDYGQQGYGQ CCCCCCCCCCCCCCC | 24.53 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYPH_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYPH_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...