| UniProt ID | SYPH_RAT | |
|---|---|---|
| UniProt AC | P07825 | |
| Protein Name | Synaptophysin | |
| Gene Name | Syp | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 307 | |
| Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Multi-pass membrane protein . Cell junction, synapse, synaptosome . |
|
| Protein Description | Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity (By similarity).. | |
| Protein Sequence | MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 53 | N-linked_Glycosylation | RLSVECANKTESALN EEEEEECCCCCCCEE | 64.54 | - | |
| 75 | Phosphorylation | PFRLHQVYFDAPSCV CEEEEEEEECCCCCC | 6.81 | 30411139 | |
| 163 | Acetylation | AKGLSDVKMATDPEN HCCCCCCEECCCHHH | 28.01 | 22902405 | |
| 184 | Phosphorylation | MCRQTGNTCKELRDP CCCCCCCCHHHHCCC | 26.71 | 25403869 | |
| 221 | Phosphorylation | LWFVFKETGWAAPFM HHHHHHCCCCCCCCC | 38.32 | - | |
| 263 | Phosphorylation | GYGPQDSYGPQGGYQ CCCCCCCCCCCCCCC | 40.91 | - | |
| 273 | Phosphorylation | QGGYQPDYGQPASGG CCCCCCCCCCCCCCC | 25.09 | - | |
| 289 | Phosphorylation | GYGPQGDYGQQGYGQ CCCCCCCCCCCCCCC | 24.53 | - |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYPH_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYPH_RAT !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...