UniProt ID | SIAH2_RAT | |
---|---|---|
UniProt AC | Q8R4T2 | |
Protein Name | E3 ubiquitin-protein ligase SIAH2 | |
Gene Name | Siah2 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 325 | |
Subcellular Localization | Cytoplasm . Nucleus . Predominantly cytoplasmic. Partially nuclear. | |
Protein Description | E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. [PubMed: 11786535 E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates] | |
Protein Sequence | MSRPSSTGPSANKPCSKQPPPPQTPHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGAGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MSRPSSTGPSANK --CCCCCCCCCCCCC | 39.81 | - | |
16 | Phosphorylation | PSANKPCSKQPPPPQ CCCCCCCCCCCCCCC | 42.74 | - | |
24 | Phosphorylation | KQPPPPQTPHAPSPA CCCCCCCCCCCCCCC | 23.86 | - | |
29 | Phosphorylation | PQTPHAPSPAAPPAA CCCCCCCCCCCCCCE | 28.14 | - | |
69 | Phosphorylation | GGGAGPVSPQHHELT CCCCCCCCCCHHHCC | 23.21 | - | |
120 | Phosphorylation | PTCRGALTPSIRNLA CCCCCCCCHHHHHHH | 17.92 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
16 | S | Phosphorylation | Kinase | DYRK2 | - | Uniprot |
24 | T | Phosphorylation | Kinase | MAPK14 | P70618 | Uniprot |
29 | S | Phosphorylation | Kinase | MAPK14 | P70618 | Uniprot |
29 | S | Phosphorylation | Kinase | DYRK2 | - | Uniprot |
69 | S | Phosphorylation | Kinase | DYRK2 | - | Uniprot |
120 | T | Phosphorylation | Kinase | DYRK2 | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
24 | T | Phosphorylation |
| - |
29 | S | Phosphorylation |
| - |
29 | S | Phosphorylation |
| - |
29 | S | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIAH2_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...