SYP52_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SYP52_ARATH
• UniProt AC: Q94KK7
• Protein Name: Syntaxin-52
• Gene Name: SYP52
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 233
• Subcellular Localization: Golgi apparatus, trans-Golgi network membrane; Single-pass type IV membrane protein. Prevacuolar compartment membrane; Single-pass type IV membrane protein.
• Protein Description: Vesicle trafficking protein that functions in the secretory pathway..
• Protein Sequence: MASSSDPWMREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLFGTDLKPDDAINRVSGMDNQGIVVFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYDVDITDSRLRRVQKSLALMNKSMKSGCSCMSMLLSVLGIVGLALVIWLLVKYL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	Phosphorylation	RKITILGTRLDSLQS HHHHHHHHHHHHHHH	25.31	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SYP52_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SYP52_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SYP52_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SYP21_ARATH	SYP21	physical	11739776
SYP22_ARATH	VAM3	physical	11739776
SYP61_ARATH	SYP61	physical	11739776

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.