| UniProt ID | SUMF2_HUMAN | |
|---|---|---|
| UniProt AC | Q8NBJ7 | |
| Protein Name | Inactive C-alpha-formylglycine-generating enzyme 2 {ECO:0000305} | |
| Gene Name | SUMF2 {ECO:0000303|PubMed:15962010, ECO:0000312|HGNC:HGNC:20415} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 301 | |
| Subcellular Localization | Endoplasmic reticulum lumen . | |
| Protein Description | Lacks formylglycine generating activity and is unable to convert newly synthesized inactive sulfatases to their active form. Inhibits the activation of sulfatases by SUMF1.. | |
| Protein Sequence | MARHGLPLLPLLSLLVGAWLKLGNGQATSMVQLQGGRFLMGTNSPDSRDGDGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAFWRQPAGPGSGIRERLEHPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNWFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNYGLYDLLGNVWEWTASPYQAAEQDMRVLRGASWIDTADGSANHRARVTTRMGNTPDSASDNLGFRCAADAGRPPGEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 40 | Sulfoxidation | LQGGRFLMGTNSPDS EECCEEEECCCCCCC | 5.98 | 28465586 | |
| 42 | O-linked_Glycosylation | GGRFLMGTNSPDSRD CCEEEECCCCCCCCC | 20.68 | OGP | |
| 47 | O-linked_Glycosylation | MGTNSPDSRDGDGPV ECCCCCCCCCCCCCC | 35.34 | 28510447 | |
| 60 | Ubiquitination | PVREATVKPFAIDIF CCCCCEECCCEEEEE | 30.02 | 21906983 | |
| 60 (in isoform 4) | Ubiquitination | - | 30.02 | 21906983 | |
| 70 | Phosphorylation | AIDIFPVTNKDFRDF EEEEEECCCCHHHHH | 36.47 | - | |
| 79 (in isoform 3) | Ubiquitination | - | 50.43 | 21890473 | |
| 79 | Ubiquitination | KDFRDFVREKKYRTE CHHHHHHHHHHHCHH | 50.43 | - | |
| 111 (in isoform 2) | Ubiquitination | - | 28.02 | 21890473 | |
| 124 (in isoform 4) | Phosphorylation | - | 8.84 | 20068231 | |
| 132 | Ubiquitination | FWRQPAGPGSGIRER HHCCCCCCCCCHHHH | 35.56 | - | |
| 153 | Methylation | HVSWNDARAYCAWRG EEEHHHHHHHHHHCC | 29.02 | 115918001 | |
| 162 | Methylation | YCAWRGKRLPTEEEW HHHHCCCCCCCHHHH | 49.04 | 115918005 | |
| 165 | Phosphorylation | WRGKRLPTEEEWEFA HCCCCCCCHHHHHHH | 61.70 | - | |
| 167 (in isoform 4) | Phosphorylation | - | 71.53 | 22210691 | |
| 170 (in isoform 4) | Phosphorylation | - | 28.78 | 22210691 | |
| 172 | Methylation | TEEEWEFAARGGLKG CHHHHHHHHHCCCCC | 5.68 | - | |
| 174 | Methylation | EEWEFAARGGLKGQV HHHHHHHHCCCCCEE | 35.96 | 115918009 | |
| 176 (in isoform 4) | Phosphorylation | - | 20.75 | 22210691 | |
| 181 | Methylation | RGGLKGQVYPWGNWF HCCCCCEEECCCCCC | 9.39 | - | |
| 184 | Phosphorylation | LKGQVYPWGNWFQPN CCCEEECCCCCCCCC | 8.61 | - | |
| 191 | N-linked_Glycosylation | WGNWFQPNRTNLWQG CCCCCCCCCCCCCCC | 53.26 | 15687489 | |
| 193 | Methylation | NWFQPNRTNLWQGKF CCCCCCCCCCCCCCC | 41.10 | - | |
| 197 | Ubiquitination | PNRTNLWQGKFPKGD CCCCCCCCCCCCCCC | 48.65 | - | |
| 199 (in isoform 1) | Ubiquitination | - | 43.31 | 21890473 | |
| 199 | Ubiquitination | RTNLWQGKFPKGDKA CCCCCCCCCCCCCCC | 43.31 | 21906983 | |
| 199 (in isoform 3) | Ubiquitination | - | 43.31 | 21890473 | |
| 210 | N-linked_Glycosylation | GDKAEDGFHGVSPVN CCCCCCCCCCCCCCC | 7.58 | 15687489 | |
| 218 | Ubiquitination | HGVSPVNAFPAQNNY CCCCCCCCCCCCCCC | 16.42 | - | |
| 218 (in isoform 3) | Ubiquitination | - | 16.42 | 21890473 | |
| 253 | Methylation | EQDMRVLRGASWIDT HHHHHHHHCCCEEEC | 35.46 | 115918013 | |
| 272 | Methylation | ANHRARVTTRMGNTP CCHHEEEEEECCCCC | 11.79 | - | |
| 275 | Sulfoxidation | RARVTTRMGNTPDSA HEEEEEECCCCCCCH | 4.57 | 21406390 | |
| 278 (in isoform 4) | Phosphorylation | - | 23.81 | 22210691 | |
| 286 (in isoform 4) | Phosphorylation | - | 9.12 | 22210691 | |
| 296 (in isoform 3) | Phosphorylation | - | 35.64 | 22210691 | |
| 304 (in isoform 3) | Phosphorylation | - | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SUMF2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SUMF2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SUMF2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FBXW7_HUMAN | FBXW7 | physical | 16169070 | |
| ANR40_HUMAN | ANKRD40 | physical | 26186194 | |
| APOD_HUMAN | APOD | physical | 26186194 | |
| CLUS_HUMAN | CLU | physical | 26186194 | |
| WDR34_HUMAN | WDR34 | physical | 26186194 | |
| APOD_HUMAN | APOD | physical | 28514442 | |
| ANR40_HUMAN | ANKRD40 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Crystal structure of human pFGE, the paralog of the Calpha-formylglycine-generating enzyme."; Dickmanns A., Schmidt B., Rudolph M.G., Mariappan M., Dierks T.,von Figura K., Ficner R.; J. Biol. Chem. 280:15180-15187(2005). Cited for: X-RAY CRYSTALLOGRAPHY (1.86 ANGSTROMS) OF 27-301 IN COMPLEX WITHCALCIUM IONS, GLYCOSYLATION AT ASN-191, AND DISULFIDE BONDS. | |
