UniProt ID | SSX5_HUMAN | |
---|---|---|
UniProt AC | O60225 | |
Protein Name | Protein SSX5 | |
Gene Name | SSX5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 188 | |
Subcellular Localization | ||
Protein Description | Could act as a modulator of transcription.. | |
Protein Sequence | MNGDDAFVRRPRVGSQIPEKMQKAFDDIAKYFSEKEWEKMKASEKIIYVYMKRKYEAMTKLGFKATLPPFMRNKRVADFQGNDFDNDPNRGNQVEHPQMTFGRLQGIFPKITPEKPAEEGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYEEISDPQEDDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Acetylation | VGSQIPEKMQKAFDD CHHCCCHHHHHHHHH | 41.08 | 19823517 | |
35 | Acetylation | IAKYFSEKEWEKMKA HHHHHCHHHHHHHHH | 67.91 | 19823523 | |
43 | Phosphorylation | EWEKMKASEKIIYVY HHHHHHHHHHEEEEE | 33.63 | 26074081 | |
48 | Phosphorylation | KASEKIIYVYMKRKY HHHHHEEEEEHHHHH | 6.76 | 26074081 | |
50 | Phosphorylation | SEKIIYVYMKRKYEA HHHEEEEEHHHHHHH | 4.67 | 26074081 | |
52 | Methylation | KIIYVYMKRKYEAMT HEEEEEHHHHHHHHH | 28.22 | - | |
60 | Methylation | RKYEAMTKLGFKATL HHHHHHHHHCCEECC | 33.26 | - | |
147 | Phosphorylation | RPSGKLNTSEKVNKT CCCCCCCCCCCCCCC | 49.01 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SSX5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SSX5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SSX5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PHS2_HUMAN | PCBD2 | physical | 20211142 | |
ZSCA1_HUMAN | ZSCAN1 | physical | 20211142 | |
ATRAP_HUMAN | AGTRAP | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...