SRSF3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SRSF3_MOUSE
• UniProt AC: P84104
• Protein Name: Serine/arginine-rich splicing factor 3
• Gene Name: Srsf3
• Organism: Mus musculus (Mouse).
• Sequence Length: 164
• Subcellular Localization: Nucleus . Nucleus speckle . Cytoplasm . Recruited to nuclear speckles following interaction with YTHDC1.
• Protein Description: Splicing factor that specifically promotes exon-inclusion during alternative splicing. Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, promotes recruitment of SRSF3 to its mRNA-binding elements adjacent to m6A sites, leading to exon-inclusion during alternative splicing. Also functions as export adapter involved in mRNA nuclear export. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity. Involved in nuclear export of m6A-containing mRNAs via interaction with YTHDC1: interaction with YTHDC1 facilitates m6A-containing mRNA-binding to both SRSF3 and NXF1, promoting mRNA nuclear export. RNA-binding is semi-sequence specific..
• Protein Sequence: MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MHRDSCPL -------CCCCCCCC	5.44	-
5	Phosphorylation	---MHRDSCPLDCKV ---CCCCCCCCCCEE	20.00	26824392
11	Ubiquitination	DSCPLDCKVYVGNLG CCCCCCCEEEEECCC	35.95	-
23	Acetylation	NLGNNGNKTELERAF CCCCCCCHHHHHHHH	44.78	-
23	Ubiquitination	NLGNNGNKTELERAF CCCCCCCHHHHHHHH	44.78	27667366
24	Phosphorylation	LGNNGNKTELERAFG CCCCCCHHHHHHHHC	50.21	25338131
32	Phosphorylation	ELERAFGYYGPLRSV HHHHHHCCCCCCEEE	9.97	22817900
70	Phosphorylation	VRELDGRTLCGCRVR HHHCCCCEECEEEEE	31.74	27600695
85	Malonylation	VELSNGEKRSRNRGP EEECCCCCCCCCCCC	58.01	26320211
85	Ubiquitination	VELSNGEKRSRNRGP EEECCCCCCCCCCCC	58.01	27667366
87	Phosphorylation	LSNGEKRSRNRGPPP ECCCCCCCCCCCCCC	45.00	29514104
95	Phosphorylation	RNRGPPPSWGRRPRD CCCCCCCCCCCCCCC	48.19	25619855
108	Phosphorylation	RDDYRRRSPPPRRRS CCCHHHCCCCCCCCC	39.69	22942356
116 (in isoform 2)	Phosphorylation	-	31.80	27600695
120	Phosphorylation	RRSPRRRSFSRSRSR CCCCCHHCHHHHHHH	26.26	18779572
122	Phosphorylation	SPRRRSFSRSRSRSL CCCHHCHHHHHHHHH	30.50	23737553
124	Phosphorylation	RRRSFSRSRSRSLSR CHHCHHHHHHHHHHH	33.15	18779572
126	Phosphorylation	RSFSRSRSRSLSRDR HCHHHHHHHHHHHHH	27.71	21659605
128	Phosphorylation	FSRSRSRSLSRDRRR HHHHHHHHHHHHHHH	31.76	23737553
130	Phosphorylation	RSRSRSLSRDRRRER HHHHHHHHHHHHHHH	33.12	23737553
138	Phosphorylation	RDRRRERSLSRERNH HHHHHHHHHHHHHCC	26.41	26824392
140	Phosphorylation	RRRERSLSRERNHKP HHHHHHHHHHHCCCC	33.08	26824392
148	Phosphorylation	RERNHKPSRSFSRSR HHHCCCCCCCHHHHH	45.41	23684622
150	Phosphorylation	RNHKPSRSFSRSRSR HCCCCCCCHHHHHHC	31.73	26824392
152	Phosphorylation	HKPSRSFSRSRSRSR CCCCCCHHHHHHCCC	30.50	23684622
154	Phosphorylation	PSRSFSRSRSRSRSN CCCCHHHHHHCCCCC	33.15	18779572
158	Phosphorylation	FSRSRSRSRSNERK- HHHHHHCCCCCCCC-	41.11	20531401
160	Phosphorylation	RSRSRSRSNERK--- HHHHCCCCCCCC---	44.27	20531401

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SRSF3_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SRSF3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SRSF3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PLCB1_RAT	Plcb1	physical	23665500
SRSF3_MOUSE	Srsf3	physical	23665500
PHB2_MOUSE	Phb2	physical	23665500

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.