SOCS3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SOCS3_MOUSE
• UniProt AC: O35718
• Protein Name: Suppressor of cytokine signaling 3
• Gene Name: Socs3
• Organism: Mus musculus (Mouse).
• Sequence Length: 225
• Protein Description: SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo. Probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Seems to recognize IL6ST..
• Protein Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
110	Phosphorylation	SLQSDPRSTQPVPRF EECCCCCCCCCCCCH	36.46	25521595
196	Phosphorylation	LQHLCRKTVNGHLDS HHHHHHHHHCCCCCH	10.39	28576409
204	Phosphorylation	VNGHLDSYEKVTQLP HCCCCCHHHHHHCCC	21.31	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
204	Y	Phosphorylation	Kinase	INSR	P06213	PSP
204	Y	Phosphorylation	Kinase	JAK2	O60674	PSP
-	K	Ubiquitination	E3 ubiquitin ligase	Socs2	O35717	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SOCS3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SOCS3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELOB_MOUSE	Tceb2	physical	9869640
ELOC_MOUSE	Tceb1	physical	9869640
ELOC_HUMAN	TCEB1	physical	19385048
ELOB_HUMAN	TCEB2	physical	19385048
INSR_MOUSE	Insr	physical	15169905
ELOC_MOUSE	Tceb1	physical	18590740
ELOB_MOUSE	Tceb2	physical	18590740
CUL5_MOUSE	Cul5	physical	18590740
JAK2_MOUSE	Jak2	physical	23454976
IL6RB_MOUSE	Il6st	physical	23454976

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.