| UniProt ID | SNN_HUMAN | |
|---|---|---|
| UniProt AC | O75324 | |
| Protein Name | Stannin | |
| Gene Name | SNN | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 88 | |
| Subcellular Localization |
Mitochondrion outer membrane Single-pass membrane protein . |
|
| Protein Description | Plays a role in the toxic effects of organotins. [PubMed: 15269288 Plays a role in endosomal maturation] | |
| Protein Sequence | MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEVHG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 42 | Phosphorylation | YLRLQRISQSEDEES HHHHHHHCCCCCCCC | 29.82 | 28060719 | |
| 44 | Phosphorylation | RLQRISQSEDEESIV HHHHHCCCCCCCCCC | 39.98 | 28060719 | |
| 49 | Phosphorylation | SQSEDEESIVGDGET CCCCCCCCCCCCCCC | 22.11 | 19664994 | |
| 56 | Phosphorylation | SIVGDGETKEPFLLV CCCCCCCCCCCEEEE | 46.36 | 26126808 | |
| 65 | Phosphorylation | EPFLLVQYSAKGPCV CCEEEEEEECCCCCH | 11.78 | 29978859 | |
| 66 | Phosphorylation | PFLLVQYSAKGPCVE CEEEEEEECCCCCHH | 13.35 | 24173317 | |
| 77 | Ubiquitination | PCVERKAKLMTPNGP CCHHCCCEECCCCCC | 41.65 | 32142685 | |
| 80 | Phosphorylation | ERKAKLMTPNGPEVH HCCCEECCCCCCCCC | 24.84 | 25159151 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNN_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNN_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNN_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LYRIC_HUMAN | MTDH | physical | 28514442 | |
| TMX1_HUMAN | TMX1 | physical | 28514442 | |
| TES_HUMAN | TES | physical | 28514442 | |
| CA131_HUMAN | C1orf131 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
