UniProt ID | SMR1_ARATH | |
---|---|---|
UniProt AC | Q9LPP4 | |
Protein Name | Cyclin-dependent protein kinase inhibitor SMR1 {ECO:0000303|PubMed:24399300, ECO:0000303|PubMed:26546445} | |
Gene Name | SMR1 {ECO:0000303|PubMed:24399300, ECO:0000303|PubMed:26546445} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 128 | |
Subcellular Localization | Nucleus . | |
Protein Description | Probable cyclin-dependent protein kinase (CDK) inhibitor that functions as a repressor of mitosis in the endoreduplication cell cycle. [PubMed: 17098811] | |
Protein Sequence | MDLELLQDLSKFNFPTPIKIRSKTSKTKKDEGDDDEDDLRCSTPTSQEHKIPAVVDSPPPPPRKPRPPPSAPSATAALMIRSCKRKLLVSTCEIIMNREEIDRFFSSVYNETSTTAKRRRSYPYCSRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
57 | Phosphorylation | KIPAVVDSPPPPPRK CCCCCCCCCCCCCCC | 27.91 | 23111157 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMR1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMR1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMR1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CKB11_ARATH | CDKB1;1 | physical | 20706207 | |
CKS2_ARATH | CKS2 | physical | 20706207 | |
CKS1_ARATH | CKS1 | physical | 20706207 | |
SURFL_ARATH | AT1G48510 | physical | 20706207 | |
RH9_ARATH | PMH1 | physical | 20706207 | |
BRM_ARATH | BRM | physical | 20706207 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...