SMR1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SMR1_ARATH
• UniProt AC: Q9LPP4
• Protein Name: Cyclin-dependent protein kinase inhibitor SMR1 {ECO:0000303|PubMed:24399300, ECO:0000303|PubMed:26546445}
• Gene Name: SMR1 {ECO:0000303|PubMed:24399300, ECO:0000303|PubMed:26546445}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 128
• Subcellular Localization: Nucleus .
• Protein Description: Probable cyclin-dependent protein kinase (CDK) inhibitor that functions as a repressor of mitosis in the endoreduplication cell cycle. [PubMed: 17098811]
• Protein Sequence: MDLELLQDLSKFNFPTPIKIRSKTSKTKKDEGDDDEDDLRCSTPTSQEHKIPAVVDSPPPPPRKPRPPPSAPSATAALMIRSCKRKLLVSTCEIIMNREEIDRFFSSVYNETSTTAKRRRSYPYCSRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
57	Phosphorylation	KIPAVVDSPPPPPRK CCCCCCCCCCCCCCC	27.91	23111157

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SMR1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SMR1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SMR1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CKB11_ARATH	CDKB1;1	physical	20706207
CKS2_ARATH	CKS2	physical	20706207
CKS1_ARATH	CKS1	physical	20706207
SURFL_ARATH	AT1G48510	physical	20706207
RH9_ARATH	PMH1	physical	20706207
BRM_ARATH	BRM	physical	20706207

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.