SKP2B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SKP2B_ARATH
• UniProt AC: O49286
• Protein Name: F-box protein SKP2B
• Gene Name: SKP2B
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 360
• Protein Description: Component of SCF(SKP2B) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of the cyclin-dependent kinase inhibitor KRP1. Does not interact with auxin..
• Protein Sequence: MVSEGATRKELNLCFENMKMEGVLISEWKDIPVELLMKILNLVDDRTVIIASCICSGWRDAVSLGLTRLSLSWCKKNMNSLVLSLAPKFVKLQTLVLRQDKPQLEDNAVEAIANHCHELQDLDLSKSSKITDHSLYSLARGCTNLTKLNLSGCTSFSDTALAHLTRFCRKLKILNLCGCVEAVSDNTLQAIGENCNQLQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCSCVLITDESVVALANRCIHLRSLGLYYCRNITDRAMYSLAQSGVKNKHEMWRAVKKGKFDEEGLRSLNISQCTYLTPSAVQAVCDTFPALHTCSGRHSLVMSGCLNLQSVHCACILQAHRTHTVYPHPAH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SKP2B_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SKP2B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SKP2B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SKP2B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CUL1_ARATH	CUL1	physical	12468727
E2FC_ARATH	ATE2F2	physical	12468727
SKP1A_ARATH	SKP1	physical	23166809
SKP1B_ARATH	ASK2	physical	23166809
ASK13_ARATH	SK13	physical	23166809

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.