SIA1A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SIA1A_MOUSE
• UniProt AC: P61092
• Protein Name: E3 ubiquitin-protein ligase SIAH1A
• Gene Name: Siah1a
• Organism: Mus musculus (Mouse).
• Sequence Length: 282
• Subcellular Localization: Cytoplasm. Nucleus. Predominantly cytoplasmic. Partially nuclear.
• Protein Description: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (ELL2, MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), the cell-surface receptor-type tyrosine kinase FLT3, the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP. Confers constitutive instability to HIPK2 through proteasomal degradation. It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription, spermatogenesis and TNF-alpha signaling. Has some overlapping function with SIAH2. Required for completion of meiosis I in males. Induces apoptosis in cooperation with PEG3. Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins..
• Protein Sequence: MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MSRQTATALPTGTS -CCCCCCCCCCCCCC	31.92	24899341
11	Phosphorylation	QTATALPTGTSKCPP CCCCCCCCCCCCCCH	54.67	24899341
19	Phosphorylation	GTSKCPPSQRVPALT CCCCCCHHHCCCCCC	18.76	-
134	Phosphorylation	SCPCPGASCKWQGSL CCCCCCCCCCCCCCH	23.34	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
19	S	Phosphorylation	Kinase	ATM	Q62388	Uniprot
19	S	Phosphorylation	Kinase	ATR	Q9JKK8	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
19	S	Phosphorylation	Phosphorylated on Ser-19 by ATM and ATR.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SIA1A_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SIA1A_MOUSE	Siah1a	physical	11742346
AFF4_MOUSE	Aff4	physical	15459319
AFF2_MOUSE	Aff2	physical	15459319
G3P_MOUSE	Gapdh	physical	16505364
PHYL_DROME	phyl	physical	12626763

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.