UniProt ID | SHH2_ARATH | |
---|---|---|
UniProt AC | Q8RWJ7 | |
Protein Name | Protein SAWADEE HOMEODOMAIN HOMOLOG 2 | |
Gene Name | SHH2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 348 | |
Subcellular Localization | Nucleus . | |
Protein Description | May play a role in the recruitment of Pol IV to genomic regions associated with K9 methylated histone H3 that are targets for RdDM.. | |
Protein Sequence | MGRPPSNGGPAFRFILPEVTEMEAILLQHNTAMPGRHILEALADKFSESPERKGKVVVQFKQIWNWFQNRRYALRARGNKAPGKLNVSSMPRMDLPNQMRSVIQPLSVPKTTHMTGNLPGMTPAPSGSLVPGVMRSGSDNSYLEFEAKSARDGAWYDVQAFLAHRNLEIGDPEVQVRFAGFEVEEDEWINVKKHVRQRSLPCEASECVAVLAGDLVLCFQEGKDQALYFDAIVLDAQRRRHDVRGCRCRFLVRYSHDQSEEIVPLRKICRRPETDYRLQQLHNAVNDLANSNQHQIPALDAAAKTPLSLPGATVPIVAPESKDPSLSATPATLVQPSSNAATVPAGSA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SHH2_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SHH2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SHH2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SHH2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATXR5_ARATH | ATXR5 | physical | 21798944 | |
TCP14_ARATH | TCP14 | physical | 21798944 | |
CONS_ARATH | CO | physical | 21798944 | |
CDC23_ARATH | APC8 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...