UniProt ID | SETLP_HUMAN | |
---|---|---|
UniProt AC | P0DME0 | |
Protein Name | Protein SETSIP | |
Gene Name | SETSIP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 302 | |
Subcellular Localization | Cytoplasm . Nucleus . Translocated from the cytoplasm to the nucleus in protein-induced pluripotent stem (PiPS) endothelial cells. | |
Protein Description | Plays a role as a transcriptional activator involved in the early stage of somatic cell reprogramming. Promotes the differentiation of protein-induced pluripotent stem (PiPS) cells into endothelial cells and the formation of vascular-like tubes (in vitro). Involved in the transcription induction of vascular endothelial-cadherin (VE-cadherin) expression. Associates to the VE-cadherin gene promoter.. | |
Protein Sequence | MVWFLDFPNSMAPKRQSPLPLQKKKPRPPPALGLEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQDSEEILKVEQKYNKLRQPFFQKRSELIAKIPNFGVTTFVNHPQVSSLLGEEDEEALHYLTKVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTKIKWKSGKDVTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELEEVIKDDIWPNPLQYYLVPDMDDEEGGEDDDDDDDDGDEGEEELEDIDEGDEDEGEEDEDDDEGEEGEEDEGEDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Phosphorylation | SMAPKRQSPLPLQKK CCCCCCCCCCCCCCC | 30622161 | ||
40 | Phosphorylation | GLEETSASAGLPKKG CCCCCCHHCCCCCCC | 22817900 | ||
49 | Acetylation | GLPKKGEKEQQEAIE CCCCCCHHHHHHHHH | 26051181 | ||
78 | Ubiquitination | QDSEEILKVEQKYNK HCHHHHHHHHHHHHH | 22817900 | ||
82 | Succinylation | EILKVEQKYNKLRQP HHHHHHHHHHHHHCC | 23954790 | ||
82 | Ubiquitination | EILKVEQKYNKLRQP HHHHHHHHHHHHHCC | 22817900 | ||
82 | Acetylation | EILKVEQKYNKLRQP HHHHHHHHHHHHHCC | 23749302 | ||
85 | Neddylation | KVEQKYNKLRQPFFQ HHHHHHHHHHCCHHH | 32015554 | ||
93 | Methylation | LRQPFFQKRSELIAK HHCCHHHHHHHHHHC | 127455561 | ||
93 | Ubiquitination | LRQPFFQKRSELIAK HHCCHHHHHHHHHHC | 23000965 | ||
93 | Acetylation | LRQPFFQKRSELIAK HHCCHHHHHHHHHHC | 23954790 | ||
136 | Phosphorylation | YLTKVEVTEFEDIKS HHEEEEEEEEECCCC | 23403867 | ||
142 | Acetylation | VTEFEDIKSGYRIDF EEEEECCCCCEEEEE | 23954790 | ||
142 | Malonylation | VTEFEDIKSGYRIDF EEEEECCCCCEEEEE | 26320211 | ||
142 | Ubiquitination | VTEFEDIKSGYRIDF EEEEECCCCCEEEEE | 23000965 | ||
142 | Methylation | VTEFEDIKSGYRIDF EEEEECCCCCEEEEE | 80475811 | ||
143 | Phosphorylation | TEFEDIKSGYRIDFY EEEECCCCCEEEEEE | 22167270 | ||
145 | Phosphorylation | FEDIKSGYRIDFYFD EECCCCCEEEEEEEC | 23403867 | ||
150 | Phosphorylation | SGYRIDFYFDENPYF CCEEEEEEECCCCCC | 27259358 | ||
156 | Phosphorylation | FYFDENPYFENKVFS EEECCCCCCCCCEEC | 25884760 | ||
171 | Phosphorylation | KEFHLNESGDPSSKS EEECCCCCCCCCCCC | 30266825 | ||
175 | Phosphorylation | LNESGDPSSKSTKIK CCCCCCCCCCCCCCE | 30266825 | ||
176 | Phosphorylation | NESGDPSSKSTKIKW CCCCCCCCCCCCCEE | 30266825 | ||
194 | Phosphorylation | KDVTKRSSQTQNKAS CCCHHHCHHHCCHHH | - | ||
199 | Ubiquitination | RSSQTQNKASRKRQH HCHHHCCHHHHHHHH | - | ||
201 | Phosphorylation | SQTQNKASRKRQHEE HHHCCHHHHHHHHCC | - | ||
211 | Phosphorylation | RQHEEPESFFTWFTD HHHCCCHHHHHHHCC | 22468782 | ||
217 | Phosphorylation | ESFFTWFTDHSDAGA HHHHHHHCCCCCCCH | 22468782 | ||
220 | Phosphorylation | FTWFTDHSDAGADEL HHHHCCCCCCCHHHH | 22468782 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SETLP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SETLP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SETLP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
P3H1_HUMAN | P3H1 | physical | 22863883 | |
NRDC_HUMAN | NRD1 | physical | 22863883 | |
PFD1_HUMAN | PFDN1 | physical | 22863883 | |
TSN_HUMAN | TSN | physical | 22863883 | |
VAT1_HUMAN | VAT1 | physical | 22863883 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...