UniProt ID | SERP1_HUMAN | |
---|---|---|
UniProt AC | Q9Y6X1 | |
Protein Name | Stress-associated endoplasmic reticulum protein 1 | |
Gene Name | SERP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 66 | |
Subcellular Localization |
Membrane Single-pass type IV membrane protein. Endoplasmic reticulum membrane Single-pass membrane protein Cytoplasmic side. |
|
Protein Description | Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins (By similarity).. | |
Protein Sequence | MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Ubiquitination | MANEKHSKNITQRGN HHHHHHCCCCHHHHC | 52.68 | 24816145 | |
21 | Methylation | HSKNITQRGNVAKTS HCCCCHHHHCHHHHC | 29.97 | - | |
26 | Ubiquitination | TQRGNVAKTSRNAPE HHHHCHHHHCCCCCH | 42.63 | 29967540 | |
37 | Phosphorylation | NAPEEKASVGPWLLA CCCHHHHCHHHHHHH | 38.38 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SERP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SERP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SERP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SCNNB_HUMAN | SCNN1B | physical | 22526458 | |
A4_HUMAN | APP | physical | 21832049 | |
SGTA_HUMAN | SGTA | physical | 20516149 | |
TMM79_HUMAN | TMEM79 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...