| UniProt ID | SCAM2_HUMAN | |
|---|---|---|
| UniProt AC | O15127 | |
| Protein Name | Secretory carrier-associated membrane protein 2 | |
| Gene Name | SCAMP2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 329 | |
| Subcellular Localization |
Golgi apparatus, trans-Golgi network membrane Multi-pass membrane protein . Recycling endosome membrane Multi-pass membrane protein . |
|
| Protein Description | Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.. | |
| Protein Sequence | MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 79 | Phosphorylation | PTPQAVVSAAQAGLL CCHHHHHHHHHHHHH | 15.99 | 30622161 | |
| 95 | Ubiquitination | QQEELDRKAAELERK HHHHHHHHHHHHHHH | 52.17 | 22053931 | |
| 109 | Phosphorylation | KERELQNTVANLHVR HHHHHHHHHHHHHHH | 14.18 | 23401153 | |
| 197 | S-palmitoylation | WFLIFTPCAFLCWYR HHHHHHHHHHHHHHH | 3.67 | 29575903 | |
| 305 | Phosphorylation | QQAQEEFSQGIFSSR HHHHHHHHCCCCCHH | 30.67 | 26074081 | |
| 310 | Phosphorylation | EFSQGIFSSRTFHRA HHHCCCCCHHHHHHH | 19.59 | 28450419 | |
| 311 | Phosphorylation | FSQGIFSSRTFHRAA HHCCCCCHHHHHHHH | 25.29 | 28450419 | |
| 313 | Phosphorylation | QGIFSSRTFHRAASS CCCCCHHHHHHHHHH | 26.24 | 26074081 | |
| 319 | Phosphorylation | RTFHRAASSAAQGAF HHHHHHHHHHHCCHH | 21.37 | 25159151 | |
| 320 | Phosphorylation | TFHRAASSAAQGAFQ HHHHHHHHHHCCHHC | 23.93 | 30266825 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCAM2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCAM2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCAM2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BAP31_HUMAN | BCAP31 | physical | 26344197 | |
| JAGN1_HUMAN | JAGN1 | physical | 26344197 | |
| PHB_HUMAN | PHB | physical | 26344197 | |
| RPN1_HUMAN | RPN1 | physical | 26344197 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-319, AND MASSSPECTROMETRY. | |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-319 AND SER-320, ANDMASS SPECTROMETRY. | |
| "Phosphoproteome of resting human platelets."; Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J.,Schuetz C., Walter U., Gambaryan S., Sickmann A.; J. Proteome Res. 7:526-534(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-319, AND MASSSPECTROMETRY. | |