UniProt ID | SCAM2_HUMAN | |
---|---|---|
UniProt AC | O15127 | |
Protein Name | Secretory carrier-associated membrane protein 2 | |
Gene Name | SCAMP2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 329 | |
Subcellular Localization |
Golgi apparatus, trans-Golgi network membrane Multi-pass membrane protein . Recycling endosome membrane Multi-pass membrane protein . |
|
Protein Description | Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.. | |
Protein Sequence | MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
79 | Phosphorylation | PTPQAVVSAAQAGLL CCHHHHHHHHHHHHH | 15.99 | 30622161 | |
95 | Ubiquitination | QQEELDRKAAELERK HHHHHHHHHHHHHHH | 52.17 | 22053931 | |
109 | Phosphorylation | KERELQNTVANLHVR HHHHHHHHHHHHHHH | 14.18 | 23401153 | |
197 | S-palmitoylation | WFLIFTPCAFLCWYR HHHHHHHHHHHHHHH | 3.67 | 29575903 | |
305 | Phosphorylation | QQAQEEFSQGIFSSR HHHHHHHHCCCCCHH | 30.67 | 26074081 | |
310 | Phosphorylation | EFSQGIFSSRTFHRA HHHCCCCCHHHHHHH | 19.59 | 28450419 | |
311 | Phosphorylation | FSQGIFSSRTFHRAA HHCCCCCHHHHHHHH | 25.29 | 28450419 | |
313 | Phosphorylation | QGIFSSRTFHRAASS CCCCCHHHHHHHHHH | 26.24 | 26074081 | |
319 | Phosphorylation | RTFHRAASSAAQGAF HHHHHHHHHHHCCHH | 21.37 | 25159151 | |
320 | Phosphorylation | TFHRAASSAAQGAFQ HHHHHHHHHHCCHHC | 23.93 | 30266825 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCAM2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCAM2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCAM2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BAP31_HUMAN | BCAP31 | physical | 26344197 | |
JAGN1_HUMAN | JAGN1 | physical | 26344197 | |
PHB_HUMAN | PHB | physical | 26344197 | |
RPN1_HUMAN | RPN1 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-319, AND MASSSPECTROMETRY. | |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-319 AND SER-320, ANDMASS SPECTROMETRY. | |
"Phosphoproteome of resting human platelets."; Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J.,Schuetz C., Walter U., Gambaryan S., Sickmann A.; J. Proteome Res. 7:526-534(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-319, AND MASSSPECTROMETRY. |