UniProt ID | S38A7_HUMAN | |
---|---|---|
UniProt AC | Q9NVC3 | |
Protein Name | Putative sodium-coupled neutral amino acid transporter 7 | |
Gene Name | SLC38A7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 462 | |
Subcellular Localization |
Membrane Multi-pass membrane protein. In neurons, located in soma and axons.. |
|
Protein Description | Mediates sodium-dependent transport of amino acids, preferentially L-glutamine.. | |
Protein Sequence | MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTSTLGAIFIVVNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISGLVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMAKEPEGASGPWYTDRKFTISLTAFLFILPLSIPREIGFQKYASFLSVVGTWYVTAIVIIKYIWPDKEMTPGNILTRPASWMAVFNAMPTICFGFQCHVSSVPVFNSMQQPEVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYQGVPVEEDVGRERRRRVLQTLVWFLLTLLLALFIPDIGKVISVIGGLAACFIFVFPGLCLIQAKLSEMEEVKPASWWVLVSYGVLLVTLGAFIFGQTTANAIFVDLLA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MAQVSINNDYSE ---CCCEEECCCCCC | 13.91 | 21955146 | |
10 | Phosphorylation | QVSINNDYSEWDLST CEEECCCCCCCCCCC | 15.60 | 20068231 | |
11 | Phosphorylation | VSINNDYSEWDLSTD EEECCCCCCCCCCCC | 34.77 | 21955146 | |
16 | Phosphorylation | DYSEWDLSTDAGERA CCCCCCCCCCHHHHH | 23.05 | 20068231 | |
17 | Phosphorylation | YSEWDLSTDAGERAR CCCCCCCCCHHHHHH | 36.85 | 25159151 | |
28 | Phosphorylation | ERARLLQSPCVDTAP HHHHHHCCCCCCCCC | 21.89 | 30266825 | |
33 | Phosphorylation | LQSPCVDTAPKSEWE HCCCCCCCCCHHHCC | 25.18 | 30266825 | |
36 | Ubiquitination | PCVDTAPKSEWEASP CCCCCCCHHHCCCCC | 59.55 | - | |
37 | O-linked_Glycosylation | CVDTAPKSEWEASPG CCCCCCHHHCCCCCC | 47.05 | OGP | |
42 | O-linked_Glycosylation | PKSEWEASPGGLDRG CHHHCCCCCCCCCCC | 16.74 | OGP | |
192 | Phosphorylation | FLFILPLSIPREIGF HHHHHCCCCCHHHCH | 28.71 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S38A7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S38A7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S38A7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TCEA1_HUMAN | TCEA1 | physical | 28514442 | |
GGA1_HUMAN | GGA1 | physical | 28514442 | |
EF1A2_HUMAN | EEF1A2 | physical | 28514442 | |
ERF1_HUMAN | ETF1 | physical | 28514442 | |
VRK1_HUMAN | VRK1 | physical | 28514442 | |
ACL6B_HUMAN | ACTL6B | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...