RSPO3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RSPO3_HUMAN
• UniProt AC: Q9BXY4
• Protein Name: R-spondin-3
• Gene Name: RSPO3
• Organism: Homo sapiens (Human).
• Sequence Length: 272
• Subcellular Localization: Secreted .
• Protein Description: Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors, which acts as a key regulator of angiogenesis. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. [PubMed: 21727895]
• Protein Sequence: MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	N-linked_Glycosylation	RQRRMHPNVSQGCQG HHHHCCCCCCCCCCC	31.24	UniProtKB CARBOHYD
186	Ubiquitination	IIQHPSAKGNLCPPT HHHCCCCCCCCCCCC	53.31	33845483
235	Phosphorylation	SKEAIPDSKSLESSK CCCCCCCCCCHHHHC	20.84	20562096
237	Phosphorylation	EAIPDSKSLESSKEI CCCCCCCCHHHHCCC	41.12	23312004
240	Phosphorylation	PDSKSLESSKEIPEQ CCCCCHHHHCCCHHH	52.59	26657352
241	Phosphorylation	DSKSLESSKEIPEQR CCCCHHHHCCCHHHH	25.57	26657352

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RSPO3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RSPO3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RSPO3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LGR4_HUMAN	LGR4	physical	24050775
ZNRF3_HUMAN	ZNRF3	physical	24050775
D19L3_HUMAN	DPY19L3	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.